• Gene id: 7358

Gene Summary

• Gene Symbol: UGDH   Gene   UCSC   Ensembl
• Aliases: EIEE84, GDH, UDP-GlcDH, UDPGDH, UGD
• Gene name: UDP-glucose 6-dehydrogenase
• Alternate names: UDP-glucose 6-dehydrogenase, UDP-Glc dehydrogenase, UDP-glucose dehydrogenase, uridine diphospho-glucose dehydrogenase,
• Gene location: 4p14 (9208394: 9140729)     Exons: 38     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene converts UDP-glucose to UDP-glucuronate and thereby participates in the biosynthesis of glycosaminoglycans such as hyaluronan, chondroitin sulfate, and heparan sulfate. These glycosylated compounds are common components of
• OMIM: 603370

Protein Summary

• Protein general information: O60701  
  • Name: UDP glucose 6 dehydrogenase (UDP Glc dehydrogenase) (UDP GlcDH) (UDPGDH) (EC 1.1.1.22)
  • Length: 494  
  • Mass: 55024
  • Tissue specificity: Detected in heart, placenta, liver, pancreas, spleen, thymus, prostate, ovary, small intestine and colon (PubMed
• Sequence:

  MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNI
  DDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKP
  NLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANA
  FLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYW
  QQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDEGAHLHIYDPKVPREQ
  IVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHN
  ELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPKV

• Structural information:
  • Interpro: IPR008927  IPR036291  IPR017476  IPR014027  IPR036220   IPR014026  IPR001732  IPR028356  
  • PDB: 2Q3E 2QG4 3ITK 3KHU 3PRJ 3PTZ 3TDK 3TF5 4EDF 4RJT 5TJH 5VR8 5W4X 6C4J 6C4K 6C58 6C5A 6C5Z
  • PDBsum: 2Q3E 2QG4 3ITK 3KHU 3PRJ 3PTZ 3TDK 3TF5 4EDF 4RJT 5TJH 5VR8 5W4X 6C4J 6C4K 6C58 6C5A 6C5Z
  • STRING: ENSP00000319501
• Other Databases: GeneCards:  UGDH  Malacards:  UGDH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0006024	glycosaminoglycan biosynthetic process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003979	UDP-glucose 6-dehydrogenase activity	IDA	molecular function
GO:0006065	UDP-glucuronate biosynthetic process	IDA	biological process
GO:0034214	protein hexamerization	IDA	biological process
GO:0001702	gastrulation with mouth forming second	ISS	biological process
GO:0030206	chondroitin sulfate biosynthetic process	ISS	biological process
GO:0015012	heparan sulfate proteoglycan biosynthetic process	ISS	biological process
GO:0003979	UDP-glucose 6-dehydrogenase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA	molecular function
GO:0051287	NAD binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0003979	UDP-glucose 6-dehydrogenase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006065	UDP-glucuronate biosynthetic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0030206	chondroitin sulfate biosynthetic process	IEA	biological process
GO:0015012	heparan sulfate proteoglycan biosynthetic process	IEA	biological process
GO:0003979	UDP-glucose 6-dehydrogenase activity	IEA	molecular function
GO:0001702	gastrulation with mouth forming second	IEA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006065	UDP-glucuronate biosynthetic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00520	Amino sugar and nucleotide sugar metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00053	Ascorbate and aldarate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881