• Gene id: 7352

Gene Summary

• Gene Symbol: UCP3   Gene   UCSC   Ensembl
• Aliases: SLC25A9
• Gene name: uncoupling protein 3
• Alternate names: mitochondrial uncoupling protein 3, solute carrier family 25 member 9, uncoupling protein 3 (mitochondrial, proton carrier),
• Gene location: 11q13.4 (74009236: 74000276)     Exons: 7     NC_000011.10
• Gene summary(Entrez): Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proto
• OMIM: 602044

Protein Summary

• Protein general information: P55916  
  • Name: Mitochondrial uncoupling protein 3 (UCP 3) (Solute carrier family 25 member 9)
  • Length: 312  
  • Mass: 34216
  • Tissue specificity: Only in skeletal muscle and heart. Is more expressed in glycolytic than in oxidative skeletal muscles. {ECO
• Sequence:

  MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPC
  SPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHL
  GPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAF
  GAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA
  LMKVQMLRESPF

• Structural information:
  • Interpro: IPR002030  IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000323740
• Other Databases: GeneCards:  UCP3  Malacards:  UCP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017077	oxidative phosphorylation uncoupler activity	IBA	molecular function
GO:1990542	mitochondrial transmembrane transport	IBA	biological process
GO:1990845	adaptive thermogenesis	IBA	biological process
GO:0009409	response to cold	IBA	biological process
GO:0006839	mitochondrial transport	IEA	biological process
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005215	transporter activity	TAS	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006629	lipid metabolic process	TAS	biological process
GO:0007585	respiratory gaseous exchange by respiratory system	TAS	biological process
GO:1902600	proton transmembrane transport	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:1902600	proton transmembrane transport	TAS	biological process
GO:1902600	proton transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0048545	response to steroid hormone	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0000303	response to superoxide	IEA	biological process
GO:0017077	oxidative phosphorylation uncoupler activity	IEA	molecular function
GO:0000303	response to superoxide	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Genetic obesity	KEGG:H02106
Genetic obesity	KEGG:H02106
Prediabetes syndrome	PMID:17587402
Coronary restenosis	PMID:17786284
diabetes mellitus	PMID:17587402
type 2 diabetes mellitus	PMID:11723073
type 2 diabetes mellitus	PMID:11126413
type 2 diabetes mellitus	PMID:9769326
type 2 diabetes mellitus	PMID:18223008
Diabetic neuropathy	PMID:16373902
obesity	PMID:12145158
obesity	PMID:9769326
obesity	PMID:18249216
hypoglycemia	PMID:10935638
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)