• Gene id: 7349

Gene Summary

• Gene Symbol: UCN   Gene   UCSC   Ensembl
• Aliases: UI, UROC
• Gene name: urocortin
• Alternate names: urocortin, prepro-urocortin, urocortin, preproprotein,
• Gene location: 2p23.3 (27308444: 27307399)     Exons: 28     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family. The encoded preproprotein is proteolytically processed to generate the mature peptide, an endogenous ligand for both corticotropin-releasing factor receptor 1 a
• OMIM: 600945

Protein Summary

• Protein general information: P55089  
  • Name: Urocortin
  • Length: 124  
  • Mass: 13458
  • Tissue specificity: Keratinocytes in epidermis and the outer and inner root sheaths of hair follicles, epithelium of sebaceous and sweat glands, erector pili muscle, cutaneous blood vessel walls, cutaneous nerves and dermal mononuclear cells (PubMed
• Sequence:

  MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGT
  AGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK

• Structural information:
  • Interpro: IPR018446  IPR000187  IPR003620  
  • Prosite: PS00511
  • PDB: 2RMF 3N96
  • PDBsum: 2RMF 3N96
  • STRING: ENSP00000296099
• Other Databases: GeneCards:  UCN  Malacards:  UCN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000252	negative regulation of feeding behavior	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007605	sensory perception of sound	IEA	biological process
GO:0005184	neuropeptide hormone activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0008306	associative learning	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IEA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043196	varicosity	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0043679	axon terminus	IEA	cellular component
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0046888	negative regulation of hormone secretion	IEA	biological process
GO:0048265	response to pain	IEA	biological process
GO:0051430	corticotropin-releasing hormone receptor 1 binding	IEA	molecular function
GO:0051966	regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0060452	positive regulation of cardiac muscle contraction	IEA	biological process
GO:2000252	negative regulation of feeding behavior	IEA	biological process
GO:2000987	positive regulation of behavioral fear response	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001664	G protein-coupled receptor binding	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0009060	aerobic respiration	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0030157	pancreatic juice secretion	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0032099	negative regulation of appetite	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0034199	activation of protein kinase A activity	IEA	biological process
GO:0035176	social behavior	IEA	biological process
GO:0035483	gastric emptying	IEA	biological process
GO:0042756	drinking behavior	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043117	positive regulation of vascular permeability	IEA	biological process
GO:0043950	positive regulation of cAMP-mediated signaling	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0045792	negative regulation of cell size	IEA	biological process
GO:0046811	histone deacetylase inhibitor activity	IEA	molecular function
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051431	corticotropin-releasing hormone receptor 2 binding	IEA	molecular function
GO:0051461	positive regulation of corticotropin secretion	IEA	biological process
GO:0060455	negative regulation of gastric acid secretion	IEA	biological process
GO:0060547	negative regulation of necrotic cell death	IEA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0090280	positive regulation of calcium ion import	IEA	biological process
GO:0097755	positive regulation of blood vessel diameter	IEA	biological process
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:0001964	startle response	IEA	biological process
GO:0010996	response to auditory stimulus	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031064	negative regulation of histone deacetylation	IEA	biological process
GO:0051461	positive regulation of corticotropin secretion	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Hypertension	PMID:16915033
hypertrophic cardiomyopathy	PMID:14577573
Cardiomyopathy	PMID:14577573
Cardiomyopathy	PMID:11087261
congestive heart failure	PMID:19808377
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R