• Gene id: 7341

Gene Summary

• Gene Symbol: SUMO1   Gene   UCSC   Ensembl
• Aliases: DAP1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, UBL1
• Gene name: small ubiquitin-like modifier 1
• Alternate names: small ubiquitin-related modifier 1, GAP modifying protein 1, SMT3 homolog 3, SMT3 suppressor of mif two 3 homolog 1, sentrin, ubiquitin-homology domain protein PIC1, ubiquitin-like protein SMT3C, ubiquitin-like protein UBL1,
• Gene location: 2q33.1 (202238598: 202206179)     Exons: 5     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unl
• OMIM: 601912

Protein Summary

• Protein general information: P63165  
  • Name: Small ubiquitin related modifier 1 (SUMO 1) (GAP modifying protein 1) (GMP1) (SMT3 homolog 3) (Sentrin) (Ubiquitin homology domain protein PIC1) (Ubiquitin like protein SMT3C) (Smt3C) (Ubiquitin like protein UBL1)
  • Length: 101  
  • Mass: 11,557
• Sequence:

  MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNH
  TPKELGMEEEDVIEVYQEQTGGHSTV

• Structural information:
  • Protein Domains: Ubiquitin-like. (20-97)
  • Interpro: IPR022617  IPR033950  IPR029071  IPR000626  
  • Prosite: PS50053
  • CDD: cd01763
  • PDB: 1A5R 1TGZ 1WYW 1Y8R 1Z5S 2ASQ 2BF8 2G4D 2IO2 2IY0 2IY1 2KQS 2LAS 2MW5 2N1A 2N1V 2PE6 2UYZ 2VRR 3KYC 3KYD 3RZW 3UIP 4WJN 4WJO 4WJP 4WJQ 5AEK 5B7A 5ELJ 5GHD
  • PDBsum: 1A5R 1TGZ 1WYW 1Y8R 1Z5S 2ASQ 2BF8 2G4D 2IO2 2IY0 2IY1 2KQS 2LAS 2MW5 2N1A 2N1V 2PE6 2UYZ 2VRR 3KYC 3KYD 3RZW 3UIP 4WJN 4WJO 4WJP 4WJQ 5AEK 5B7A 5ELJ 5GHD
  • DIP: 29080
  • STRING: ENSP00000376076
• Other Databases: GeneCards:  SUMO1  Malacards:  SUMO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000792	heterochromatin	IEA	cellular component
GO:0001650	fibrillar center	IEA	cellular component
GO:0001741	XY body	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005643	nuclear pore	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006281	DNA repair	TAS	biological process
GO:0006303	double-strand break repair via nonhomologous end joining	TAS	biological process
GO:0008134	transcription factor binding	ISS	molecular function
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0016604	nuclear body	IDA	cellular component
GO:0016605	PML body	IDA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030578	PML body organization	IEA	biological process
GO:0031334	positive regulation of protein complex assembly	IDA	biological process
GO:0031386	protein tag	IBA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031965	nuclear membrane	IDA	cellular component
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0032880	regulation of protein localization	TAS	biological process
GO:0043392	negative regulation of DNA binding	IMP	biological process
GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	IMP	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0045759	negative regulation of action potential	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0060021	palate development	ISS	biological process
GO:0060334	regulation of interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0086004	regulation of cardiac muscle cell contraction	IEA	biological process
GO:0090204	protein localization to nuclear pore	IEA	biological process
GO:1901896	positive regulation of calcium-transporting ATPase activity	IEA	biological process
GO:1902260	negative regulation of delayed rectifier potassium channel activity	IDA	biological process
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0016605	PML body	IDA	cellular component
GO:0000792	heterochromatin	IEA	cellular component
GO:0001650	fibrillar center	IEA	cellular component
GO:0001741	XY body	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005643	nuclear pore	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006281	DNA repair	TAS	biological process
GO:0006303	double-strand break repair via nonhomologous end joining	TAS	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0008134	transcription factor binding	ISS	molecular function
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016604	nuclear body	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0016605	PML body	IDA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0016925	protein sumoylation	IEA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030578	PML body organization	IEA	biological process
GO:0031334	positive regulation of protein complex assembly	IDA	biological process
GO:0031386	protein tag	IBA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031647	regulation of protein stability	IEA	biological process
GO:0031965	nuclear membrane	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0032880	regulation of protein localization	TAS	biological process
GO:0043392	negative regulation of DNA binding	IMP	biological process
GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	IMP	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0045759	negative regulation of action potential	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0060021	palate development	IEA	biological process
GO:0060021	palate development	ISS	biological process
GO:0060334	regulation of interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0086004	regulation of cardiac muscle cell contraction	IEA	biological process
GO:0090204	protein localization to nuclear pore	IEA	biological process
GO:1901896	positive regulation of calcium-transporting ATPase activity	IEA	biological process
GO:1902260	negative regulation of delayed rectifier potassium channel activity	IDA	biological process
GO:1903169	regulation of calcium ion transmembrane transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0016605	PML body	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005643	nuclear pore	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006281	DNA repair	TAS	biological process
GO:0006303	double-strand break repair via nonhomologous end joining	TAS	biological process
GO:0008134	transcription factor binding	ISS	molecular function
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0016604	nuclear body	IDA	cellular component
GO:0016605	PML body	IDA	cellular component
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0031334	positive regulation of protein complex assembly	IDA	biological process
GO:0031386	protein tag	IBA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031965	nuclear membrane	IDA	cellular component
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0032880	regulation of protein localization	TAS	biological process
GO:0043392	negative regulation of DNA binding	IMP	biological process
GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	IMP	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045759	negative regulation of action potential	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0060021	palate development	ISS	biological process
GO:0060334	regulation of interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:1902260	negative regulation of delayed rectifier potassium channel activity	IDA	biological process
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0016605	PML body	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05418	Fluid shear stress and atherosclerosis

Diseases

Associated diseases	References
Cancer (lung)	GAD: 19859084
Cleft defects	OMIM: 19937600
Poor sperm motility	MIK: 25118297
Abnormal spermatogenesis	MIK: 16352666
Male infertility	MIK: 16352666
Spermatogenic defects	MIK: 16352666
Poor sperm motility	MIK: 25118297
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16352666	Male infertility, Abnormal spermatogenesis				Male infertility
25118297	Poor sperm motility				Male infertility	DRP1 RanGAP1 Topoisomerase Ii? SUMO1
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)