• Gene id: 734

Gene Summary

• Gene Symbol: OSGIN2   Gene   UCSC   Ensembl
• Aliases: C8orf1, hT41
• Gene name: oxidative stress induced growth inhibitor family member 2
• Alternate names: oxidative stress-induced growth inhibitor 2,
• Gene location: 8q21.3 (42491140: 42412436)     Exons: 24     NC_000015.10
• OMIM: 604598

SNPs

rs11531577

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.100180604G>T
NC_000007.13   g.99778227G>T
NG_034114.1   g.7881G>T
NM_012447.4   c.48G>T
NM_012447.3   c.48G>T
NM_012447.2   c.48G>T
NM_001282718.2   c.48G>T
NM_001282718.1   c.48G>T
NM_001282717.1   c.48G>T
NM_001282716.1   c.48G>T
XM_017011683.2   c.48G>

rs10841496

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.20368720C>A
NC_000012.11   g.20521654C>A
NG_030033.1   g.4476C>A
NM_000921.5   c.-565C>A
NM_001378408.1   c.-1593C>A
NM_001378407.1   c.-565C>A|SEQ=[C/A]|GENE=PDE3A

rs1727130

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.100213841C>A
NC_000007.14   g.100213841C>G
NC_000007.14   g.100213841C>T
NC_000007.13   g.99811464C>A
NC_000007.13   g.99811464C>G
NC_000007.13   g.99811464C>T
NG_034114.1   g.41118C>A
NG_034114.1   g.41118C>G
NG_034114.1   g.41118C>T|SEQ=[C/A/G/T]|GE

Protein Summary

• Protein general information: Q9Y236  
  • Name: Oxidative stress induced growth inhibitor 2 (hT41)
  • Length: 505  
  • Mass: 56672
  • Tissue specificity: Ubiquitous. Expressed at higher levels in testis and ovary.
• Sequence:

  MPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDLEYLSE
  GLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHVVLGKGPPGGAWHNMEGSMLTISFGSWMELP
  GLKFKDWVSSKRRSLKGDRVMPEEIARYYKHYVKVMGLQKNFRENTYITSVSRLYRDQDDDDIQDRDISTKHLQI
  EKSNFIKRNWEIRGYQRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGK
  VDPVLIVGSGLTAADAVLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSNLLSDY
  TSFPEHRVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQPITCKGNPVEIDTYT
  YECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGGDGIA

• Structural information:
  • Interpro: IPR036188  IPR029731  IPR029728  
  • STRING: ENSP00000396445
• Other Databases: GeneCards:  OSGIN2  Malacards:  OSGIN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008083	growth factor activity	IBA	molecular function
GO:0030308	negative regulation of cell growth	IBA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881