• Gene id: 733

Gene Summary

• Gene Symbol: C8G   Gene   UCSC   Ensembl
• Aliases: C8C
• Gene name: complement C8 gamma chain
• Alternate names: complement component C8 gamma chain, complement component 8, gamma polypeptide,
• Gene location: 9q34.3 (136944869: 136946980)     Exons: 7     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the lipocalin family. It is one of the three subunits that constitutes complement component 8 (C8), which is composed of a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chai
• OMIM: 601825

Protein Summary

• Protein general information: P07360  
  • Name: Complement component C8 gamma chain
  • Length: 202  
  • Mass: 22277
• Sequence:

  MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTL
  HVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKL
  YARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

• Structural information:
  • Interpro: IPR002968  IPR012674  IPR022272  IPR000566  
  • Prosite: PS00213
  • PDB: 1IW2 1LF7 2OVA 2OVD 2OVE 2QOS 2RD7 3OJY 6H03 6H04
  • PDBsum: 1IW2 1LF7 2OVA 2OVD 2OVE 2QOS 2RD7 3OJY 6H03 6H04
  • STRING: ENSP00000224181
• Other Databases: GeneCards:  C8G  Malacards:  C8G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001848	complement binding	IBA	molecular function
GO:0005579	membrane attack complex	IEA	cellular component
GO:0006956	complement activation	IEA	biological process
GO:0019835	cytolysis	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006957	complement activation, alternative pathway	IEA	biological process
GO:0005579	membrane attack complex	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0019841	retinol binding	IEA	molecular function
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030449	regulation of complement activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0001848	complement binding	IEA	molecular function
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05322	Systemic lupus erythematosus
hsa05146	Amoebiasis
hsa04610	Complement and coagulation cascades
hsa05020	Prion diseases

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray