• Gene id: 7328

Gene Summary

• Gene Symbol: UBE2H   Gene   UCSC   Ensembl
• Aliases: E2-20K, GID3, UBC8, UBCH, UBCH2
• Gene name: ubiquitin conjugating enzyme E2 H
• Alternate names: ubiquitin-conjugating enzyme E2 H, (E3-independent) E2 ubiquitin-conjugating enzyme H, E2 ubiquitin-conjugating enzyme H, GID complex subunit 3, UBC8 homolog, ubiquitin carrier protein H, ubiquitin conjugating enzyme E2H, ubiquitin-conjugating enzyme E2-20K, ubi,
• Gene location: 7q32.2 (161118042: 161100555)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju
• OMIM: 601082

Protein Summary

• Protein general information: P62256  
  • Name: Ubiquitin conjugating enzyme E2 H (EC 2.3.2.23) ((E3 independent) E2 ubiquitin conjugating enzyme H) (EC 2.3.2.24) (E2 ubiquitin conjugating enzyme H) (UbcH2) (Ubiquitin carrier protein H) (Ubiquitin conjugating enzyme E2 20K) (Ubiquitin protein ligase H)
  • Length: 183  
  • Mass: 20655
• Sequence:

  MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIF
  HPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYAT
  EEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 2Z5D
  • PDBsum: 2Z5D
  • STRING: ENSP00000347836
• Other Databases: GeneCards:  UBE2H  Malacards:  UBE2H

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray