• Gene id: 7325

Gene Summary

• Gene Symbol: UBE2E2   Gene   UCSC   Ensembl
• Aliases: UBCH8
• Gene name: ubiquitin conjugating enzyme E2 E2
• Alternate names: ubiquitin-conjugating enzyme E2 E2, E2 ubiquitin-conjugating enzyme E2, ubiquitin carrier protein E2, ubiquitin conjugating enzyme E2E 2, ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast), ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5,
• Gene location: 3p24.3 (23203006: 23591924)     Exons: 13     NC_000003.12
• OMIM: 602163

Protein Summary

• Protein general information: Q96LR5  
  • Name: Ubiquitin conjugating enzyme E2 E2 (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme E2) (UbcH8) (Ubiquitin carrier protein E2) (Ubiquitin protein ligase E2)
  • Length: 201  
  • Mass: 22255
• Sequence:

  MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNC
  SAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPA
  LTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 1Y6L
  • PDBsum: 1Y6L
  • DIP: 52704
  • STRING: ENSP00000379931
• Other Databases: GeneCards:  UBE2E2  Malacards:  UBE2E2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042296	ISG15 transferase activity	IDA	molecular function
GO:0032020	ISG15-protein conjugation	IDA	biological process
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0032020	ISG15-protein conjugation	IBA	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0042296	ISG15 transferase activity	IBA	molecular function
GO:0070534	protein K63-linked ubiquitination	IBA	biological process
GO:0070936	protein K48-linked ubiquitination	IBA	biological process
GO:0070979	protein K11-linked ubiquitination	IBA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IDA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IDA	molecular function
GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	IGI	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0070534	protein K63-linked ubiquitination	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq