• Gene id: 7324

Gene Summary

• Gene Symbol: UBE2E1   Gene   UCSC   Ensembl
• Aliases: UBCH6
• Gene name: ubiquitin conjugating enzyme E2 E1
• Alternate names: ubiquitin-conjugating enzyme E2 E1, (E3-independent) E2 ubiquitin-conjugating enzyme E1, E2 ubiquitin-conjugating enzyme E1, ubiquitin carrier protein E1, ubiquitin conjugating enzyme E2E 1, ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast), ubiquitin-,
• Gene location: 3p24.2 (23805954: 23891639)     Exons: 7     NC_000003.12
• Gene summary(Entrez): The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju
• OMIM: 602916

Protein Summary

• Protein general information: P51965  
  • Name: Ubiquitin conjugating enzyme E2 E1 (EC 2.3.2.23) ((E3 independent) E2 ubiquitin conjugating enzyme E1) (EC 2.3.2.24) (E2 ubiquitin conjugating enzyme E1) (UbcH6) (Ubiquitin carrier protein E1) (Ubiquitin protein ligase E1)
  • Length: 193  
  • Mass: 21404
• Sequence:

  MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDN
  IYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLL
  SICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 1XR9 3BZH 4JJQ 5LBN 6FGA
  • PDBsum: 1XR9 3BZH 4JJQ 5LBN 6FGA
  • STRING: ENSP00000303709
• Other Databases: GeneCards:  UBE2E1  Malacards:  UBE2E1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042296	ISG15 transferase activity	IDA	molecular function
GO:0032020	ISG15-protein conjugation	IDA	biological process
GO:0070936	protein K48-linked ubiquitination	IBA	biological process
GO:0042296	ISG15 transferase activity	IBA	molecular function
GO:0033523	histone H2B ubiquitination	IBA	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0032020	ISG15-protein conjugation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IDA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:1901990	regulation of mitotic cell cycle phase transition	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IDA	molecular function
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0010390	histone monoubiquitination	IDA	biological process
GO:0033523	histone H2B ubiquitination	IDA	biological process
GO:0000151	ubiquitin ligase complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R