• Gene id: 7320

Gene Summary

• Gene Symbol: UBE2B   Gene   UCSC   Ensembl
• Aliases: E2-17kDa, HHR6B, HR6B, RAD6B, UBC2
• Gene name: ubiquitin conjugating enzyme E2 B
• Alternate names: ubiquitin-conjugating enzyme E2 B, E2 protein, E2 ubiquitin-conjugating enzyme B, RAD6 homolog B, ubiquitin carrier protein B, ubiquitin conjugating enzyme E2B, ubiquitin-conjugating enzyme E2-17 kDa, ubiquitin-conjugating enzyme E2B (RAD6 homolog), ubiqu,
• Gene location: 5q31.1 (134371175: 134392107)     Exons: 6     NC_000005.10
• Gene summary(Entrez): The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju
• OMIM: 179095

SNPs

rs17167484

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.134371303T>G
NC_000005.9   g.133706994T>G
NG_042179.2   g.4745A>C
NG_046936.1   g.5128T>G
NM_003337.3   c.-293T>G
XM_017009544.2   c.-937A>C
XM_017009545.2   c.-742A>C
XM_024446086.1   c.-327A>C
XM_024446097.1   c.-729A>C
XM_024446096.1   c.-708A>C
XM_0  

rs3777373

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.134391612A>G
NC_000005.9   g.133727303A>G
NG_046936.1   g.25437A>G
NM_003337.4   c.*1259A>G
NM_003337.3   c.*1259A>G
NM_003337.2   c.*1259A>G|SEQ=[A/G]|GENE=UBE2B

Protein Summary

• Protein general information: P63146  
  • Name: Ubiquitin conjugating enzyme E2 B (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme B) (RAD6 homolog B) (HR6B) (hHR6B) (Ubiquitin carrier protein B) (Ubiquitin conjugating enzyme E2 17 kDa) (Ubiquitin protein ligase B)
  • Length: 152  
  • Mass: 17,312
• Sequence:

  MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSK
  MFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWN
  DS

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 1JAS 1NXA 2Y4W 2YB6 2YBF
  • PDBsum: 1JAS 1NXA 2Y4W 2YB6 2YBF
  • DIP: 29832
  • STRING: ENSP00000265339
• Other Databases: GeneCards:  UBE2B  Malacards:  UBE2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000209	protein polyubiquitination	IMP	biological process
GO:0000785	chromatin	ISS	cellular component
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001741	XY body	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IMP	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005657	replication fork	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006281	DNA repair	IGI	biological process
GO:0006301	postreplication repair	IDA	biological process
GO:0006301	postreplication repair	NAS	biological process
GO:0006344	maintenance of chromatin silencing	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	NAS	biological process
GO:0006513	protein monoubiquitination	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0007288	sperm axoneme assembly	IEA	biological process
GO:0009411	response to UV	IGI	biological process
GO:0010845	positive regulation of reciprocal meiotic recombination	IEA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0033128	negative regulation of histone phosphorylation	IEA	biological process
GO:0033503	HULC complex	IDA	cellular component
GO:0033522	histone H2A ubiquitination	IMP	biological process
GO:0042493	response to drug	IDA	biological process
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IDA	biological process
GO:0045141	meiotic telomere clustering	IEA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0051026	chiasma assembly	IEA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	ISS	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0070076	histone lysine demethylation	IEA	biological process
GO:0070193	synaptonemal complex organization	IEA	biological process
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000209	protein polyubiquitination	IMP	biological process
GO:0000785	chromatin	IEA	cellular component
GO:0000785	chromatin	ISS	cellular component
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001741	XY body	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IMP	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005657	replication fork	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006281	DNA repair	IGI	biological process
GO:0006301	postreplication repair	IDA	biological process
GO:0006301	postreplication repair	NAS	biological process
GO:0006344	maintenance of chromatin silencing	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	NAS	biological process
GO:0006513	protein monoubiquitination	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0007288	sperm axoneme assembly	IEA	biological process
GO:0009411	response to UV	IGI	biological process
GO:0010845	positive regulation of reciprocal meiotic recombination	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0031056	regulation of histone modification	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0033128	negative regulation of histone phosphorylation	IEA	biological process
GO:0033503	HULC complex	IDA	cellular component
GO:0033522	histone H2A ubiquitination	IMP	biological process
GO:0042493	response to drug	IDA	biological process
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IDA	biological process
GO:0045141	meiotic telomere clustering	IEA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0051026	chiasma assembly	IEA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	ISS	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0070076	histone lysine demethylation	IEA	biological process
GO:0070193	synaptonemal complex organization	IEA	biological process
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	IMP	biological process
GO:0000785	chromatin	ISS	cellular component
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IMP	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005657	replication fork	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006281	DNA repair	IGI	biological process
GO:0006301	postreplication repair	IDA	biological process
GO:0006301	postreplication repair	NAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	NAS	biological process
GO:0006513	protein monoubiquitination	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0009411	response to UV	IGI	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0033503	HULC complex	IDA	cellular component
GO:0033522	histone H2A ubiquitination	IMP	biological process
GO:0042493	response to drug	IDA	biological process
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IDA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	ISS	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 23378580
Oligozoospermia	MIK: 23378580
Azoospermia	MIK: 26223869
Associated with male sterility	MIK: 8797826
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Azoospermia	MIK: 18385908
Oligozoospermia	MIK: 18385908
Male infertility	MIK: 23079972
Spermatogenic defects	MIK: 23863405
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26223869	idiopathic azoospermia	(Chr5.133706925 A?>?G)		1485 (776 patients diagnosed with idiopathic azoospermia (IA), 709 proven fertile men)	Male infertility
18385908	Azoospermia, oligospermia				Male infertility
23378580	Severe oligozoospermia, Male infertility	c.-31T>C, c.48TTA>TTT (p.L16L), c.-10G>T, c.-28C>T, c.406CGA>AGA (p.R134R), c.57GAC>GAT (p.D19D), c.426TCG>TCA (p.S142S), c.-125_8del133bp (del125 5?UTR, p.M1-L9del), c.127_131delCCAGA spl ex3 (p.P43Rins2X)		747 (326 oligozoospermic patients, 421 normozoospermic men)	Male infertility
23079972	Male infertility	UBE2B polymorphisms g.-293T>G (rs17167484), g.20016A>G (rs3777373), g.9157A>G	Northea st Chin a	700 (312 fertile males, 388 infertile males )	Male infertility
18497339	Idiopathic male infertility	UBE2B (g.5197:T>G; g.9157:A>G)		830 (530 infertile (350 azoospermic, 105 oligoasthenoteratozoospermic, and 75 oligoasthenozoospermic), 300 fertile control men )	Male infertility	UBE2B
8797826	Associated with male sterility				Male infertility
23863405	Role in spermatogenesis				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881