• Gene id: 7301

Gene Summary

• Gene Symbol: TYRO3   Gene   UCSC   Ensembl
• Aliases: BYK, Dtk, Etk-2, RSE, Rek, Sky, Tif
• Gene name: TYRO3 protein tyrosine kinase
• Alternate names: tyrosine-protein kinase receptor TYRO3, tyrosine-protein kinase DTK, tyrosine-protein kinase RSE, tyrosine-protein kinase SKY, tyrosine-protein kinase TIF, tyrosine-protein kinase byk,
• Gene location: 15q15.1 (41559211: 41583588)     Exons: 21     NC_000015.10
• Gene summary(Entrez): The gene is part of a 3-member transmembrane receptor kinase receptor family with a processed pseudogene distal on chromosome 15. The encoded protein is activated by the products of the growth arrest-specific gene 6 and protein S genes and is involved in
• OMIM: 600341

Protein Summary

• Protein general information: Q06418  
  • Name: Tyrosine protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine protein kinase BYK) (Tyrosine protein kinase DTK) (Tyrosine protein kinase RSE) (Tyrosine protein kinase SKY) (Tyrosine protein kinase TIF)
  • Length: 890  
  • Mass: 96905
  • Tissue specificity: Abundant in the brain and lower levels in other tissues.
• Sequence:

  MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPVKLNCSVEGMEEPDIQ
  WVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV
  PPNAPFQLSCEAVGPPEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALP
  AAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRC
  ANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGPYKLSWVQDNGTQDELTVE
  GTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALALIL
  LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG
  KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPM
  VILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFG
  LSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNR
  LKQPPECMEDVYDLMYQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRD
  QPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC

• Structural information:
  • Protein Domains: (41..12-)
    1 (/note="Ig-like-C2-type)
    (139..22-)
    2 (/note="Ig-like-C2-type)
    (227..32-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (325..41-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO-)
  • Interpro: IPR003961  IPR036116  IPR007110  IPR036179  IPR013783   IPR013098  IPR003599  IPR003598  IPR011009  IPR000719  IPR017441  IPR001245  IPR008266  IPR020635  
  • Prosite: PS50853 PS50835 PS00107 PS50011 PS00109
  • CDD: cd00063
  • PDB: 1RHF
  • PDBsum: 1RHF
  • STRING: ENSP00000263798
• Other Databases: GeneCards:  TYRO3  Malacards:  TYRO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043235	receptor complex	IBA	cellular component
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0006909	phagocytosis	IBA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0070527	platelet aggregation	IBA	biological process
GO:0007399	nervous system development	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0021885	forebrain cell migration	IEA	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0042698	ovulation cycle	IEA	biological process
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0045824	negative regulation of innate immune response	IEA	biological process
GO:0051250	negative regulation of lymphocyte activation	IEA	biological process
GO:0070050	neuron cellular homeostasis	IEA	biological process
GO:0001779	natural killer cell differentiation	IEA	biological process
GO:0032940	secretion by cell	IEA	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	IEA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0043277	apoptotic cell clearance	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0060068	vagina development	IEA	biological process
GO:0070527	platelet aggregation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0070050	neuron cellular homeostasis	ISS	biological process
GO:0045824	negative regulation of innate immune response	ISS	biological process
GO:0042698	ovulation cycle	ISS	biological process
GO:0030168	platelet activation	ISS	biological process
GO:0021885	forebrain cell migration	ISS	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	NAS	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0050728	negative regulation of inflammatory response	ISS	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0034446	substrate adhesion-dependent cell spreading	ISS	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	ISS	biological process
GO:0007155	cell adhesion	NAS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0043548	phosphatidylinositol 3-kinase binding	IPI	molecular function
GO:0043491	protein kinase B signaling	ISS	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	NAS	molecular function
GO:0070527	platelet aggregation	ISS	biological process
GO:0043277	apoptotic cell clearance	ISS	biological process
GO:0032940	secretion by cell	ISS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005635	nuclear envelope	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)