• Gene id: 729956

Gene Summary

• Gene Symbol: SHISA7   Gene   UCSC   Ensembl
• Aliases: CKAMP59
• Gene name: shisa family member 7
• Alternate names: protein shisa-7, GABA(A) receptor auxiliary subunit Shisa7, UPF0626 protein A, cystine-knot AMPAR modulating protein of 59 kDa, shisa homolog 7,
• Gene location: 19q13.42 (55442862: 55428737)     Exons: 4     NC_000019.10

Protein Summary

• Protein general information: A6NL88  
  • Name: Protein shisa 7 (Cystine knot AMPAR modulating protein of 59 kDa) (CKAMP59) (GABA(A) receptor auxiliary subunit Shisa7) (Protein shisa 6 like)
  • Length: 538  
  • Mass: 56214
• Sequence:

  MPALLLLVLLASSAGQARARPSNATSAEPAGPLPALLAHLRRLTGALTGGGGAASPGANGTRTGPAGGAGAAARA
  PPPAELCHGYYDVMGQYDATFNCSTGSYRFCCGTCHYRFCCEHRHMRLAQASCSNYDTPRWATTPPPLAGGAGGA
  GGAGGGPGPGQAGWLEGGRTGGAGGRGGEGPGGSTAYVVCGVISFALAVGVGAKVAFSKASRAPRAHRDINVPRA
  LVDILRHQAGPGTRPDRARSSSLTPGIGGPDSMPPRTPKNLYNTVKTPNLDWRALPPPSPSLHYSTLSCSRSFHN
  LSHLPPSYEAAVKSELNRYSSLKRLAEKDLDEAYLKRRPLELPRGTLPLHALRRPGTGGGYRMEAWGGPEELGLA
  PAPNPRRVMSQEHLLGDGGRSRYEFTLPRARLVSQEHLLLSSPEALRQSREHLLSPPRSPALPPDPTARASLAAS
  HSNLLLGPGGPPTPLRGLPPPSSLHAHHHHALHGSPQPAWMSDAGGGGGTLARRPPFQRQGTLEQLQFIPGHHLP
  QHLRTASKNEVTV

• Structural information:
  • Interpro: IPR026910  
  • STRING: ENSP00000365503
• Other Databases: GeneCards:  SHISA7  Malacards:  SHISA7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032591	dendritic spine membrane	IBA	cellular component
GO:2000311	regulation of AMPA receptor activity	IBA	biological process
GO:0048172	regulation of short-term neuronal synaptic plasticity	IBA	biological process
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0032281	AMPA glutamate receptor complex	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0098985	asymmetric, glutamatergic, excitatory synapse	ISS	NOT|cellular component
GO:0098978	glutamatergic synapse	ISS	NOT|cellular component
GO:0035255	ionotropic glutamate receptor binding	ISS	NOT|molecular function
GO:0050811	GABA receptor binding	ISS	molecular function
GO:0097112	gamma-aminobutyric acid receptor clustering	ISS	biological process
GO:0098985	asymmetric, glutamatergic, excitatory synapse	ISS	cellular component
GO:0035255	ionotropic glutamate receptor binding	ISS	molecular function
GO:0007613	memory	ISS	biological process
GO:0032281	AMPA glutamate receptor complex	ISS	NOT|cellular component
GO:2000311	regulation of AMPA receptor activity	ISS	NOT|biological process
GO:0106040	regulation of GABA-A receptor activity	ISS	biological process
GO:0007214	gamma-aminobutyric acid signaling pathway	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:1904717	regulation of AMPA glutamate receptor clustering	ISS	biological process
GO:1900273	positive regulation of long-term synaptic potentiation	ISS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007613	memory	IEA	biological process
GO:0050811	GABA receptor binding	IEA	molecular function
GO:0097112	gamma-aminobutyric acid receptor clustering	IEA	biological process
GO:0098962	regulation of postsynaptic neurotransmitter receptor activity	IEA	biological process
GO:0007214	gamma-aminobutyric acid signaling pathway	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IEA	cellular component
GO:0106040	regulation of GABA-A receptor activity	IEA	biological process
GO:1900273	positive regulation of long-term synaptic potentiation	IEA	biological process
GO:1904717	regulation of AMPA glutamate receptor clustering	IEA	biological process
GO:0098839	postsynaptic density membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq