• Gene id: 7298

Gene Summary

• Gene Symbol: TYMS   Gene   UCSC   Ensembl
• Aliases: HST422, TMS, TS
• Gene name: thymidylate synthetase
• Alternate names: thymidylate synthase, TSase,
• Gene location: 18p11.32 (131904092: 132013641)     Exons: 26     NC_000008.11
• Gene summary(Entrez): Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication an
• OMIM: 188350

Protein Summary

• Protein general information: P04818  
  • Name: Thymidylate synthase (TS) (TSase) (EC 2.1.1.45)
  • Length: 313  
  • Mass: 35716
• Sequence:

  MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLT
  TKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDME
  SDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPF
  NIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEG
  YNPHPTIKMEMAV

• Structural information:
  • Interpro: IPR023451  IPR036926  IPR000398  IPR020940  
  • Prosite: PS00091
  • CDD: cd00351
  • PDB: 1HVY 1HW3 1HW4 1HZW 1I00 1JU6 1JUJ 1YPV 2ONB 2RD8 2RDA 3EAW 3EBU 3ED7 3EDW 3EF9 3EGY 3EHI 3EJL 3GG5 3GH0 3GH2 3H9K 3HB8 3N5E 3N5G 3OB7 4E28 4FGT 4G2O 4G6W 4GD7 4GYH 4H1I 4JEF 4KPW 4O1U 4O1X 4UP1 5HS3 5WRN 5X4W 5X4X 5X4Y 5X5A 5X5D 5X5Q 5X66 5X67 5X69 6OJU 6OJV 6PF3 6PF4 6PF5 6PF6 6QXG 6QXH 6QYQ 6R2E
  • PDBsum: 1HVY 1HW3 1HW4 1HZW 1I00 1JU6 1JUJ 1YPV 2ONB 2RD8 2RDA 3EAW 3EBU 3ED7 3EDW 3EF9 3EGY 3EHI 3EJL 3GG5 3GH0 3GH2 3H9K 3HB8 3N5E 3N5G 3OB7 4E28 4FGT 4G2O 4G6W 4GD7 4GYH 4H1I 4JEF 4KPW 4O1U 4O1X 4UP1 5HS3 5WRN 5X4W 5X4X 5X4Y 5X5A 5X5D 5X5Q 5X66 5X67 5X69 6OJU 6OJV 6PF3 6PF4 6PF5 6PF6 6QXG 6QXH 6QYQ 6R2E
  • STRING: ENSP00000315644
• Other Databases: GeneCards:  TYMS  Malacards:  TYMS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0006231	dTMP biosynthetic process	IBA	biological process
GO:0004799	thymidylate synthase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004799	thymidylate synthase activity	IEA	molecular function
GO:0006231	dTMP biosynthetic process	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0009165	nucleotide biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004799	thymidylate synthase activity	IEA	molecular function
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0097421	liver regeneration	IEA	biological process
GO:0048589	developmental growth	IEA	biological process
GO:0046078	dUMP metabolic process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0033189	response to vitamin A	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0007623	circadian rhythm	IEA	biological process
GO:0006231	dTMP biosynthetic process	IEA	biological process
GO:0006206	pyrimidine nucleobase metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005542	folic acid binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0060574	intestinal epithelial cell maturation	IEA	biological process
GO:0051593	response to folic acid	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0046653	tetrahydrofolate metabolic process	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0034097	response to cytokine	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0019860	uracil metabolic process	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0004799	thymidylate synthase activity	IEA	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0005542	folic acid binding	IC	molecular function
GO:0004799	thymidylate synthase activity	IDA	molecular function
GO:0071897	DNA biosynthetic process	IC	biological process
GO:0006231	dTMP biosynthetic process	IDA	biological process
GO:0035999	tetrahydrofolate interconversion	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006235	dTTP biosynthetic process	IEA	biological process
GO:0006231	dTMP biosynthetic process	IDA	biological process
GO:0006231	dTMP biosynthetic process	IDA	biological process
GO:0000900	translation repressor activity, mRNA regulatory element binding	IDA	molecular function
GO:0004799	thymidylate synthase activity	TAS	molecular function
GO:0017148	negative regulation of translation	IDA	biological process
GO:1990825	sequence-specific mRNA binding	IDA	molecular function
GO:0004799	thymidylate synthase activity	IDA	molecular function
GO:0004799	thymidylate synthase activity	IDA	molecular function
GO:0046683	response to organophosphorus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00240	Pyrimidine metabolism
hsa01523	Antifolate resistance
hsa00670	One carbon pool by folate

Diseases

Associated diseases	References
Colon carcinoma	PMID:17848948
hepatocellular carcinoma	PMID:17659576
Rheumatoid arthritis	PMID:22763757
acute myeloid leukemia	PMID:18774170
multiple myeloma	PMID:17512053
acute lymphocytic leukemia	PMID:25007187
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray