• Gene id: 7297

Gene Summary

• Gene Symbol: TYK2   Gene   UCSC   Ensembl
• Aliases: IMD35, JTK1
• Gene name: tyrosine kinase 2
• Alternate names: non-receptor tyrosine-protein kinase TYK2,
• Gene location: 19p13.2 (10380571: 10350527)     Exons: 29     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphoryl
• OMIM: 176941

Protein Summary

• Protein general information: P29597  
  • Name: Non receptor tyrosine protein kinase TYK2 (EC 2.7.10.2)
  • Length: 1187  
  • Mass: 133,650
• Sequence:

  MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHIAHKVGITPPCFNLFA
  LFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREPAVYRCGPPGTEASSDQTAQGMQLLDPASFE
  YLFEQGKHEFVNDVASLWELSTEEEIHHFKNESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQ
  HSALTRLRLRNVFRRFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
  TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWA
  YFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLVDGYFRLTADSSHYLCHEVAPPRLVMSIRDG
  IHGPLLEPFVQAKLRPEDGLYLIHWSTSHPYRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPS
  VRELGAALQGCLLRAGDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
  TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETASLMSQVSHTHLAFVHG
  VCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLASALSYLENKNLVHGNVCGRNILLARLGLAEG
  TSPFIKLSDPGVGLGALSREERVERIPWLAPECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEH
  FYQRQHRLPEPSCPQLATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
  RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQ
  LVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPE
  GHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLT
  ELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC

• Structural information:
  • Protein Domains: FERM. (26-431)
    SH (450-529)
    (-)
    Protein (589-875)
    Protein (897-1176)
  • Interpro: IPR019749  IPR035963  IPR000299  IPR011009  IPR000719   IPR017441  IPR001245  IPR000980  IPR036860  IPR008266  IPR020635  IPR016251  IPR016045  
  • Prosite: PS50057 PS00107 PS50011 PS00109
  • PDB: 3LXN 3LXP 3NYX 3NZ0 3ZON 4GFO 4GIH 4GII 4GJ2 4GJ3 4GVJ 4OLI 4PO6 4PY1 4WOV 5C01 5C03 5F1Z 5F20 5TKD 5WAL
  • PDBsum: 3LXN 3LXP 3NYX 3NZ0 3ZON 4GFO 4GIH 4GII 4GJ2 4GJ3 4GVJ 4OLI 4PO6 4PY1 4WOV 5C01 5C03 5F1Z 5F20 5TKD 5WAL
  • DIP: 1062
  • STRING: ENSP00000264818
• Other Databases: GeneCards:  TYK2  Malacards:  TYK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0005131	growth hormone receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0031702	type 1 angiotensin receptor binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0060338	regulation of type I interferon-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	TAS	molecular function
GO:0005131	growth hormone receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0031702	type 1 angiotensin receptor binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0060338	regulation of type I interferon-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	TAS	molecular function
GO:0005131	growth hormone receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0060338	regulation of type I interferon-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04217	Necroptosis
hsa04621	NOD-like receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa04380	Osteoclast differentiation
hsa05162	Measles
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05165	Human papillomavirus infection
hsa05145	Toxoplasmosis

Diseases

Associated diseases	References
Cancer	GAD: 18270328
Cancer (myeloid leukemia)	GAD: 20065083
Cancer (ovarian)	GAD: 20628624
Cancer (thyroid)	GAD: 19730683
Cancer (leukemia)	GAD: 18270328
Cancer (meningeal)	GAD: 20406964
Lymphoproliferative disorders	GAD: 19464057
Crohn's disease	GAD: 19249008
Rheumatoid arthritis	GAD: 17599733
Psoriasis	GAD: 20953190
Multiple sclerosis	GAD: 19293837
Systemic lupus erythematosus (SLE)	GAD: 15657875
Systemic lupus erythematosus (SLE)	GAD: 19442287
Other well-defined immunodeficiency syndromes	KEGG: H00107
Diabetes	GAD: 19966805
Chronic renal failure	GAD: 21085059
Endometriosis-associated infertility	INFBASE: 23000200
Male factor infertility	MIK: 11476770
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 11476770

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
11476770	Male factor infertility			9 sperm donors	Male infertility	TYK 2 STAT 1 IFN-alpha IFN-gamma IL-12 TYK 2 STAT 4
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq