• Gene id: 729533

Gene Summary

• Gene Symbol: FAM72A   Gene   UCSC   Ensembl
• Aliases: LMPIP, Ugene, p17
• Gene name: family with sequence similarity 72 member A
• Alternate names: protein FAM72A, LMP1-induced protein, latent membrane protein 1-induced protein,
• Gene location: 1q32.1 (206205345: 206186178)     Exons: 1     NC_000001.11
• OMIM: 614710

Protein Summary

• Protein general information: Q5TYM5  
  • Name: Protein FAM72A (Latent membrane protein 1 induced protein) (LMP1 induced protein) (LMPIP)
  • Length: 149  
  • Mass: 16619
  • Tissue specificity: May be up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. Expression is also elevated in other common cancer types, including breast, lung, uterus, and ovary. {ECO
• Sequence:

  MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACL
  KCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR

• Structural information:
  • Interpro: IPR026768  
  • STRING: ENSP00000356096
• Other Databases: GeneCards:  FAM72A  Malacards:  FAM72A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)