• Gene id: 7293

Gene Summary

• Gene Symbol: TNFRSF4   Gene   UCSC   Ensembl
• Aliases: ACT35, CD134, IMD16, OX40, TXGP1L
• Gene name: TNF receptor superfamily member 4
• Alternate names: tumor necrosis factor receptor superfamily member 4, ACT35 antigen, ATC35 antigen, CD134 antigen, OX40 antigen, OX40 cell surface antigen, OX40 homologue, OX40L receptor, TAX transcriptionally-activated glycoprotein 1 receptor, lymphoid activation antigene ACT35, t,
• Gene location: 1p36.33 (1216811: 1211325)     Exons: 9     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes
• OMIM: 600315

Protein Summary

• Protein general information: P43489  
  • Name: Tumor necrosis factor receptor superfamily member 4 (ACT35 antigen) (OX40L receptor) (TAX transcriptionally activated glycoprotein 1 receptor) (CD antigen CD134)
  • Length: 277  
  • Mass: 29341
• Sequence:

  MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDV
  VSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLA
  GKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVL
  GLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI

• Structural information:
  • Interpro: IPR001368  IPR020445  IPR034022  IPR011641  
  • Prosite: PS00652 PS50050
  • CDD: cd13406
  • PDB: 1D0A 2HEV 2HEY 6OGX 6OKM 6OKN
  • PDBsum: 1D0A 2HEV 2HEY 6OGX 6OKM 6OKN
  • DIP: 3024
  • STRING: ENSP00000368538
• Other Databases: GeneCards:  TNFRSF4  Malacards:  TNFRSF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005031	tumor necrosis factor-activated receptor activity	IBA	molecular function
GO:0050710	negative regulation of cytokine secretion	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042098	T cell proliferation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0042098	T cell proliferation	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0030890	positive regulation of B cell proliferation	ISS	biological process
GO:0051024	positive regulation of immunoglobulin secretion	ISS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Combined immunodeficiency	KEGG:H00093
Combined immunodeficiency	KEGG:H00093
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq