• Gene id: 7292

Gene Summary

• Gene Symbol: TNFSF4   Gene   UCSC   Ensembl
• Aliases: CD134L, CD252, GP34, OX-40L, OX4OL, TNLG2B, TXGP1
• Gene name: TNF superfamily member 4
• Alternate names: tumor necrosis factor ligand superfamily member 4, CD134 ligand, OX40 antigen ligand, glycoprotein Gp34, tax-transcriptionally activated glycoprotein 1 (34kD), tumor necrosis factor (ligand) superfamily member 4, tumor necrosis factor ligand 2B, tumor necrosis f,
• Gene location: 1q25.1 (173462207: 173183728)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene h

Protein Summary

• Protein general information: P23510  
  • Name: Tumor necrosis factor ligand superfamily member 4 (Glycoprotein Gp34) (OX40 ligand) (OX40L) (TAX transcriptionally activated glycoprotein 1) (CD antigen CD252)
  • Length: 183  
  • Mass: 21050
• Sequence:

  MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGF
  ILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVY
  LNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

• Structural information:
  • Interpro: IPR021184  IPR006052  IPR042338  IPR008983  
  • Prosite: PS00251
  • CDD: cd00184
  • PDB: 2HEV
  • PDBsum: 2HEV
  • DIP: 3023
  • STRING: ENSP00000281834
• Other Databases: GeneCards:  TNFSF4  Malacards:  TNFSF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001819	positive regulation of cytokine production	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0032813	tumor necrosis factor receptor superfamily binding	IBA	molecular function
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032813	tumor necrosis factor receptor superfamily binding	ISS	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0032753	positive regulation of interleukin-4 production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IDA	biological process
GO:0002215	defense response to nematode	ISS	biological process
GO:0002726	positive regulation of T cell cytokine production	ISS	biological process
GO:0002819	regulation of adaptive immune response	ISS	biological process
GO:0002891	positive regulation of immunoglobulin mediated immune response	ISS	biological process
GO:0009615	response to virus	ISS	biological process
GO:0032733	positive regulation of interleukin-10 production	ISS	biological process
GO:0035712	T-helper 2 cell activation	ISS	biological process
GO:0035713	response to nitrogen dioxide	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0045630	positive regulation of T-helper 2 cell differentiation	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0046641	positive regulation of alpha-beta T cell proliferation	ISS	biological process
GO:0050727	regulation of inflammatory response	ISS	biological process
GO:0071954	chemokine (C-C motif) ligand 11 production	ISS	biological process
GO:2000572	positive regulation of interleukin-4-dependent isotype switching to IgE isotypes	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0032700	negative regulation of interleukin-17 production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0002526	acute inflammatory response	ISS	biological process
GO:0002830	positive regulation of type 2 immune response	ISS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0032689	negative regulation of interferon-gamma production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032736	positive regulation of interleukin-13 production	ISS	biological process
GO:0035709	memory T cell activation	ISS	biological process
GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS	biological process
GO:0043382	positive regulation of memory T cell differentiation	ISS	biological process
GO:0045590	negative regulation of regulatory T cell differentiation	ISS	biological process
GO:0045626	negative regulation of T-helper 1 cell differentiation	ISS	biological process
GO:0050871	positive regulation of B cell activation	ISS	biological process
GO:0051024	positive regulation of immunoglobulin secretion	ISS	biological process
GO:1900281	positive regulation of CD4-positive, alpha-beta T cell costimulation	ISS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0001819	positive regulation of cytokine production	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0032813	tumor necrosis factor receptor superfamily binding	IBA	molecular function
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032813	tumor necrosis factor receptor superfamily binding	ISS	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0032753	positive regulation of interleukin-4 production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IDA	biological process
GO:0002215	defense response to nematode	ISS	biological process
GO:0002726	positive regulation of T cell cytokine production	ISS	biological process
GO:0002819	regulation of adaptive immune response	ISS	biological process
GO:0002891	positive regulation of immunoglobulin mediated immune response	ISS	biological process
GO:0009615	response to virus	ISS	biological process
GO:0032733	positive regulation of interleukin-10 production	ISS	biological process
GO:0035712	T-helper 2 cell activation	ISS	biological process
GO:0035713	response to nitrogen dioxide	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0045630	positive regulation of T-helper 2 cell differentiation	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0046641	positive regulation of alpha-beta T cell proliferation	ISS	biological process
GO:0050727	regulation of inflammatory response	ISS	biological process
GO:0071954	chemokine (C-C motif) ligand 11 production	ISS	biological process
GO:2000572	positive regulation of interleukin-4-dependent isotype switching to IgE isotypes	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0032700	negative regulation of interleukin-17 production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0002526	acute inflammatory response	ISS	biological process
GO:0002830	positive regulation of type 2 immune response	ISS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0032689	negative regulation of interferon-gamma production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032736	positive regulation of interleukin-13 production	ISS	biological process
GO:0035709	memory T cell activation	ISS	biological process
GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS	biological process
GO:0043382	positive regulation of memory T cell differentiation	ISS	biological process
GO:0045590	negative regulation of regulatory T cell differentiation	ISS	biological process
GO:0045626	negative regulation of T-helper 1 cell differentiation	ISS	biological process
GO:0050871	positive regulation of B cell activation	ISS	biological process
GO:0051024	positive regulation of immunoglobulin secretion	ISS	biological process
GO:1900281	positive regulation of CD4-positive, alpha-beta T cell costimulation	ISS	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Systemic sclerosis	KEGG:H01492
Systemic sclerosis	KEGG:H01492
Myocardial infarction	PMID:15750594
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881