• Gene id: 728695

Gene Summary

• Gene Symbol: SPANXB1   Gene   UCSC   Ensembl
• Aliases: B1, CT11.2, SPANX-B, SPANXB, SPANXB2, SPANXF1, SPANXF2
• Gene name: SPANX family member B1
• Alternate names: sperm protein associated with the nucleus on the X chromosome B1, SPANX family member B/F, SPANX family member F1, SPANX family, member B2, SPANX family, member F2, cancer/testis antigen 11.2, cancer/testis antigen family 11, member 2, nuclear-associated protei,
• Gene location: Xq27.1 (141002593: 141003705)     Exons: 2     NC_000023.11
• Gene summary(Entrez): Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a m
• OMIM: 300669

Protein Summary

• Protein general information: Q9NS25  
  • Name: Sperm protein associated with the nucleus on the X chromosome B1 (Cancer/testis antigen 11.2) (CT11.2) (Nuclear associated protein SPAN Xb) (SPANX B) (SPANX family member B1) (SPANX family member F1)
  • Length: 103  
  • Mass: 11840
  • Tissue specificity: Detected in testis and sperm. {ECO
• Sequence:

  MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELLN
  DHARENRINPDQMEEEEFIEITTERPKK

• Structural information:
  • Interpro: IPR010007  
  • STRING: ENSP00000405202
• Other Databases: GeneCards:  SPANXB1  Malacards:  SPANXB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0007286	spermatid development	NAS	biological process

Diseases

Associated diseases	References
Asthenozoospermia	MIK: 25825237
Asthenozoospermia	MIK: 25825237
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25825237	Asthenozoospermia				Male infertility	Tubulin beta 2B; glutathione S-transferase Mu 3; keratin type II cytoskeletal 1; outer dense fiber protein 2; voltage-dependent anion-selective channel protein 2; A-kinase anchor protein 4; cytochrome c oxidase subunit 6B; sperm protein associated with t
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray