• Gene id: 728642

Gene Summary

• Gene Symbol: CDK11A   Gene   UCSC   Ensembl
• Aliases: CDC2L2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, PITSLRE, p58GTA
• Gene name: cyclin dependent kinase 11A
• Alternate names: cyclin-dependent kinase 11A, PITSLRE B, PITSLRE protein kinase beta SV1 isoform, PITSLRE protein kinase beta SV16 isoform, PITSLRE protein kinase beta SV17 isoform, PITSLRE protein kinase beta SV18 isoform, PITSLRE protein kinase beta SV2 isoform, PITSLRE protei,
• Gene location: 1p36.33 (1724356: 1702378)     Exons: 20     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighb
• OMIM: 616601

Protein Summary

• Protein general information: Q9UQ88  
  • Name: Cyclin dependent kinase 11A (EC 2.7.11.22) (Cell division cycle 2 like protein kinase 2) (Cell division protein kinase 11A) (Galactosyltransferase associated protein kinase p58/GTA) (PITSLRE serine/threonine protein kinase CDC2L2)
  • Length: 783  
  • Mass: 91362
  • Tissue specificity: Expressed ubiquitously. Some evidence of isoform-specific tissue distribution. {ECO
• Sequence:

  MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHCMEITIRNSPYRREDSMED
  RGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKWKHARVKEREHERRKRHREEQDKARREWERQKRREMAREHSR
  RERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPR
  PPRERFELGDGRKPGEARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEE
  EEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSEDEERENENHLLVVPESRFDRDSGESEEA
  EEEVGEGTPQSSALTEGDYVPDSPALLPIELKQELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDE
  IVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPG
  EVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGA
  KEYSTAVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKELGTPSEKIWPGYSELPVVKKMTFSEHPYNNLRKR
  FGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGY
  SQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF

• Structural information:
  • Protein Domains: (427..64-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR008271  
  • Prosite: PS50011 PS00108
• Other Databases: GeneCards:  CDK11A  Malacards:  CDK11A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0050684	regulation of mRNA processing	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0000278	mitotic cell cycle	NAS	biological process
GO:0001558	regulation of cell growth	IEP	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0004672	protein kinase activity	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq