• Gene id: 728

Gene Summary

• Gene Symbol: C5AR1   Gene   UCSC   Ensembl
• Aliases: C5A, C5AR, C5R1, CD88
• Gene name: complement C5a receptor 1
• Alternate names: C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin receptor, C5a ligand, C5a-R, complement component 5 receptor 1, complement component 5a receptor 1,
• Gene location: 19q13.32 (47309860: 47322065)     Exons: 3     NC_000019.10

SNPs

rs7354779

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000021.9   g.44250887T>C
NC_000021.8   g.45670770T>C
NM_013369.3   c.832A>G
NM_013369.4   c.832A>G
NM_175867.2   c.832A>G
NM_175867.3   c.832A>G
NR_135514.1   n.75T>C
NP_037501.2   p.Arg278Gly
NP_787063.1   p.Arg278Gly|SEQ=[T/C]|GENE=DNMT3L
DNMT3L-AS1   1053728

rs4938723

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.111511840T>C
NC_000011.9   g.111382565T>C|SEQ=[T/C]|GENE=BTG4
MIR34B   407041
MIR34C   407042
LOC728196   728196

rs1800566

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.69711242G>A
NC_000016.9   g.69745145G>A
NG_011504.2   g.20389C>T
NG_011504.1   g.20389C>T
NM_000903.3   c.559C>T
NM_000903.2   c.559C>T
NM_001025433.2   c.457C>T
NM_001025433.1   c.457C>T
NM_001025434.2   c.445C>T
NM_001025434.1   c.445C>T
NM_001286137.  

Protein Summary

• Protein general information: P21730  
  • Name: C5a anaphylatoxin chemotactic receptor 1 (C5a anaphylatoxin chemotactic receptor) (C5a R) (C5aR) (CD antigen CD88)
  • Length: 350  
  • Mass: 39336
• Sequence:

  MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWF
  LNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFKPIWCQNFRGA
  GLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFI
  LLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
  VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

• Structural information:
  • Interpro: IPR001274  IPR002234  IPR000826  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 5O9H 6C1Q 6C1R
  • PDBsum: 5O9H 6C1Q 6C1R
  • STRING: ENSP00000347197
• Other Databases: GeneCards:  C5AR1  Malacards:  C5AR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902947	regulation of tau-protein kinase activity	ISS	biological process
GO:0099172	presynapse organization	ISS	biological process
GO:0048143	astrocyte activation	ISS	biological process
GO:0001774	microglial cell activation	ISS	biological process
GO:0050890	cognition	ISS	biological process
GO:0097242	amyloid-beta clearance	ISS	biological process
GO:0002430	complement receptor mediated signaling pathway	IBA	biological process
GO:0004875	complement receptor activity	IBA	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004878	complement component C5a receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0045177	apical part of cell	IDA	cellular component
GO:0042789	mRNA transcription by RNA polymerase II	IDA	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0004878	complement component C5a receptor activity	IDA	molecular function
GO:0004875	complement receptor activity	IEA	molecular function
GO:0004878	complement component C5a receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004878	complement component C5a receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007202	activation of phospholipase C activity	TAS	biological process
GO:0007606	sensory perception of chemical stimulus	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0030449	regulation of complement activation	TAS	biological process
GO:1902947	regulation of tau-protein kinase activity	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0032494	response to peptidoglycan	IEA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IEA	biological process
GO:0021534	cell proliferation in hindbrain	IEA	biological process
GO:0001856	complement component C5a binding	IEA	molecular function
GO:0099172	presynapse organization	IEA	biological process
GO:0097242	amyloid-beta clearance	IEA	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0050890	cognition	IEA	biological process
GO:0048143	astrocyte activation	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IEA	biological process
GO:0004878	complement component C5a receptor activity	IEA	molecular function
GO:0001774	microglial cell activation	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004878	complement component C5a receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0038178	complement component C5a signaling pathway	IDA	biological process
GO:0004878	complement component C5a receptor activity	IDA	molecular function
GO:0004930	G protein-coupled receptor activity	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05150	Staphylococcus aureus infection
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Alzheimer's disease	PMID:12759460
Asthma	PMID:15940127
Chronic obstructive pulmonary disease	PMID:19926870
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R