• Gene id: 7277

Gene Summary

• Gene Symbol: TUBA4A   Gene   UCSC   Ensembl
• Aliases: ALS22, H2-ALPHA, TUBA1
• Gene name: tubulin alpha 4a
• Alternate names: tubulin alpha-4A chain, tubulin H2-alpha, tubulin alpha-1 chain, tubulin, alpha 1 (testis specific),
• Gene location: 2q35 (219254607: 219249710)     Exons: 5     NC_000002.12
• Gene summary(Entrez): Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of si
• OMIM: 191110

Protein Summary

• Protein general information: P68366  
  • Name: Tubulin alpha 4A chain (Alpha tubulin 1) (Testis specific alpha tubulin) (Tubulin H2 alpha) (Tubulin alpha 1 chain)
  • Length: 448  
  • Mass: 49,924
• Sequence:

  MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVI
  DEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFT
  SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYT
  NLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
  QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV
  CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE

• Structural information:
  • Interpro: IPR002452  IPR008280  IPR000217  IPR018316  IPR037103   IPR036525  IPR023123  IPR017975  IPR003008  
  • Prosite: PS00227
  • STRING: ENSP00000248437
• Other Databases: GeneCards:  TUBA4A  Malacards:  TUBA4A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005200	structural constituent of cytoskeleton	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0007017	microtubule-based process	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005200	structural constituent of cytoskeleton	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0007017	microtubule-based process	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa04210	Apoptosis
hsa04530	Tight junction
hsa04540	Gap junction
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Amyotrophic lateral sclerosis (ALS)	KEGG: H00058
Asthenozoospermia	MIK: 24268707
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 24268707

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24268707	Asthenozoospermia			100 (50 men with normal sperm parameters, 50 men with asthenozoospermia)	Male infertility	UBA3C TUBA4A and TUBA8
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881