• Gene id: 7270

Gene Summary

• Gene Symbol: TTF1   Gene   UCSC   Ensembl
• Aliases: TTF-1, TTF-I
• Gene name: transcription termination factor 1
• Alternate names: transcription termination factor 1, transcription termination factor, RNA polymerase I,
• Gene location: 9q34.13 (16022035: 16034049)     Exons: 20     NC_000001.11
• Gene summary(Entrez): This gene encodes a transcription termination factor that is localized to the nucleolus and plays a critical role in ribosomal gene transcription. The encoded protein mediates the termination of RNA polymerase I transcription by binding to Sal box termina
• OMIM: 600777

Protein Summary

• Protein general information: Q15361  
  • Name: Transcription termination factor 1 (TTF 1) (RNA polymerase I termination factor) (Transcription termination factor I) (TTF I)
  • Length: 905  
  • Mass: 103051
• Sequence:

  MEGESSRFEIHTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQHLISSPLKKSRICDE
  TANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFRKDVDVVCVDMSIEQKLPRKPKTDKFQVLAK
  SHAHKSEALHSKVREKKNKKHQRKAASWESQRARDTLPQSESHQEESWLSVGPGGEITELPASAHKNKSKKKKKK
  SSNREYETLAMPEGSQAGREAGTDMQESQPTVGLDDETPQLLGPTHKKKSKKKKKKKSNHQEFEALAMPEGSQVG
  SEVGADMQESRPAVGLHGETAGIPAPAYKNKSKKKKKKSNHQEFEAVAMPESLESAYPEGSQVGSEVGTVEGSTA
  LKGFKESNSTKKKSKKRKLTSVKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKH
  VQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAVKQLQEFIPNIKDRATSTIKRMYRDDLERFK
  EFKAQGVAIKFGKFSVKENKQLEKNVEDFLALTGIESADKLLYTDRYPEEKSVITNLKRRYSFRLHIGRNIARPW
  KLIYYRAKKMFDVNNYKGRYSEGDTEKLKMYHSLLGNDWKTIGEMVARSSLSVALKFSQISSQRNRGAWSKSETR
  KLIKAVEEVILKKMSPQELKEVDSKLQENPESCLSIVREKLYKGISWVEVEAKVQTRNWMQCKSKWTEILTKRMT
  NGRRIYYGMNALRAKVSLIERLYEINVEDTNEIDWEDLASAIGDVPPSYVQTKFSRLKAVYVPFWQKKTFPEIID
  YLYETTLPLLKEKLEKMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQ
  GRWII

• Structural information:
  • Protein Domains: (612..66-)
    (/note="Myb-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00133-)
    (661..74-)
    (/note="Myb-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00133"-)
  • Interpro: IPR017877  IPR001005  
  • Prosite: PS50090
  • STRING: ENSP00000333920
• Other Databases: GeneCards:  TTF1  Malacards:  TTF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IBA	molecular function
GO:0005730	nucleolus	IBA	cellular component
GO:0006363	termination of RNA polymerase I transcription	IBA	biological process
GO:0008156	negative regulation of DNA replication	IEA	biological process
GO:0006353	DNA-templated transcription, termination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006363	termination of RNA polymerase I transcription	TAS	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006353	DNA-templated transcription, termination	NAS	biological process
GO:0005634	nucleus	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04918	Thyroid hormone synthesis

Diseases

Associated diseases	References
Benign hereditary chorea	KEGG:H00860
Benign hereditary chorea	KEGG:H00860
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881