• Gene id: 7266

Gene Summary

• Gene Symbol: DNAJC7   Gene   UCSC   Ensembl
• Aliases: DJ11, DJC7, TPR2, TTC2
• Gene name: DnaJ heat shock protein family (Hsp40) member C7
• Alternate names: dnaJ homolog subfamily C member 7, DnaJ (Hsp40) homolog, subfamily C, member 7, TPR repeat protein 2, tetratricopeptide repeat domain 2, tetratricopeptide repeat protein 2,
• Gene location: 17q21.2 (105137156: 105096821)     Exons: 11     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90
• OMIM: 601964

Protein Summary

• Protein general information: Q99615  
  • Name: DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2)
  • Length: 494  
  • Mass: 56441
• Sequence:

  MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMML
  GRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAE
  TDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDC
  IEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNR
  GTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELK
  KSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSG
  QDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG

• Structural information:
  • Protein Domains: (381..45-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR001623  IPR036869  IPR013026  IPR011990  IPR019734  
  • Prosite: PS50076 PS50005 PS50293
  • CDD: cd06257
  • STRING: ENSP00000406463
• Other Databases: GeneCards:  DNAJC7  Malacards:  DNAJC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051085	chaperone cofactor-dependent protein refolding	IDA	biological process
GO:0051085	chaperone cofactor-dependent protein refolding	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray