• Gene id: 7265

Gene Summary

• Gene Symbol: TTC1   Gene   UCSC   Ensembl
• Aliases: TPR1
• Gene name: tetratricopeptide repeat domain 1
• Alternate names: tetratricopeptide repeat protein 1, TPR repeat protein 1,
• Gene location: 5q33.3 (160009099: 160065544)     Exons: 8     NC_000005.10
• Gene summary(Entrez): This gene encodes a protein that belongs to the tetratrico peptide repeat superfamily of proteins. The encoded protein plays a role in protein-protein interactions, and binds to the Galpha subunit of G protein-coupled receptors to activate the Ras signali
• OMIM: 601963

Protein Summary

• Protein general information: Q99614  
  • Name: Tetratricopeptide repeat protein 1 (TPR repeat protein 1)
  • Length: 292  
  • Mass: 33526
• Sequence:

  MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASFEEEPG
  ADKVENKSNEDVNSSELDEEYLIELEKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYSRALEMCPSCF
  QKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALEDYKSILEKDPSIHQA
  REACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR

• Structural information:
  • Interpro: IPR013026  IPR011990  IPR001440  IPR019734  
  • Prosite: PS50005 PS50293
  • STRING: ENSP00000231238
• Other Databases: GeneCards:  TTC1  Malacards:  TTC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005778	peroxisomal membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006457	protein folding	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051082	unfolded protein binding	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881