• Gene id: 7263

Gene Summary

• Gene Symbol: TST   Gene   UCSC   Ensembl
• Aliases: RDS
• Gene name: thiosulfate sulfurtransferase
• Alternate names: thiosulfate sulfurtransferase, epididymis secretory sperm binding protein, thiosulfate sulfurtransferase (rhodanese),
• Gene location: 22q12.3 (37020182: 37010858)     Exons: 4     NC_000022.11
• Gene summary(Entrez): This is one of two neighboring genes encoding similar proteins that each contain two rhodanese domains. The encoded protein is localized to the mitochondria and catalyzes the conversion of thiosulfate and cyanide to thiocyanate and sulfite. In addition, t
• OMIM: 0

Protein Summary

• Protein general information: Q16762  
  • Name: Thiosulfate sulfurtransferase (EC 2.8.1.1) (Rhodanese)
  • Length: 297  
  • Mass: 33429
• Sequence:

  MVHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDTASPYEMML
  PSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP
  AVFKATLDRSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKG
  PEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKSEKA

• Structural information:
  • Protein Domains: (25..14-)
    (/note="Rhodanese-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173-)
    (173..28-)
    (/note="Rhodanese-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173"-)
  • Interpro: IPR001763  IPR036873  IPR001307  
  • Prosite: PS00380 PS00683 PS50206
  • STRING: ENSP00000385828
• Other Databases: GeneCards:  TST  Malacards:  TST

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004792	thiosulfate sulfurtransferase activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0019346	transsulfuration	IBA	biological process
GO:0051029	rRNA transport	IDA	biological process
GO:0008097	5S rRNA binding	IDA	molecular function
GO:0008097	5S rRNA binding	IDA	molecular function
GO:0035928	rRNA import into mitochondrion	IMP	biological process
GO:0004792	thiosulfate sulfurtransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0004792	thiosulfate sulfurtransferase activity	TAS	molecular function
GO:0005759	mitochondrial matrix	NAS	cellular component
GO:0009440	cyanate catabolic process	TAS	biological process
GO:0004792	thiosulfate sulfurtransferase activity	IEA	molecular function
GO:0000098	sulfur amino acid catabolic process	TAS	biological process
GO:0004792	thiosulfate sulfurtransferase activity	TAS	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0030855	epithelial cell differentiation	IDA	biological process
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00270	Cysteine and methionine metabolism
hsa00920	Sulfur metabolism
hsa04122	Sulfur relay system

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq