• Gene id: 7260

Gene Summary

• Gene Symbol: EIPR1   Gene   UCSC   Ensembl
• Aliases: EIPR-1, TSSC1
• Gene name: EARP complex and GARP complex interacting protein 1
• Alternate names: EARP and GARP complex-interacting protein 1, EARP-interacting protein, Golgi-associated retrograde protein-interacting protein, endosome-associated recycling protein-interacting protein, protein TSSC1, tumor suppressing subtransferable candidate 1, tumor-suppre,
• Gene location: 2p25.3 (3377817: 3188924)     Exons: 13     NC_000002.12
• Gene summary(Entrez): This gene has been reported in PMID 9403053 as one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the
• OMIM: 608965

Protein Summary

• Protein general information: Q53HC9  
  • Name: EARP and GARP complex interacting protein 1 (Endosome associated recycling protein interacting protein) (Golgi associated retrograde protein interacting protein) (Tumor suppressing STF cDNA 1 protein) (Tumor suppressing subchromosomal transferable fragmen
  • Length: 387  
  • Mass: 43603
• Sequence:

  MEDDAPVIYGLEFQARALTPQTAETDAIRFLVGTQSLKYDNQIHIIDFDDENNIINKNVLLHQAGEIWHISASPA
  DRGVLTTCYNRTSDSKVLTCAAVWRMPKELESGSHESPDDSSSTAQTLELLCHLDNTAHGNMACVVWEPMGDGKK
  IISLADNHILLWDLQESSSQAVLASSASLEGKGQLKFTSGRWSPHHNCTQVATANDTTLRGWDTRSMSQIYCIEN
  AHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTEPVKTLEEHSHWVWNVRYNHSHDQLVLTGSSDSRVILS
  NMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSVYAVDWSSADPWLFASLSYDGRLVIN
  RVPRALKYHILL

• Structural information:
  • Interpro: IPR040323  IPR015943  IPR001680  IPR019775  IPR017986  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000371559
• Other Databases: GeneCards:  EIPR1  Malacards:  EIPR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016567	protein ubiquitination	IBA	biological process
GO:2001137	positive regulation of endocytic recycling	IDA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:1990745	EARP complex	IDA	colocalizes with
GO:0000938	GARP complex	IDA	colocalizes with
GO:1905281	positive regulation of retrograde transport, endosome to Golgi	IDA	biological process
GO:0032456	endocytic recycling	ISS	biological process
GO:0050796	regulation of insulin secretion	ISS	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq