• Gene id: 7257

Gene Summary

• Gene Symbol: TSNAX   Gene   UCSC   Ensembl
• Aliases: C3PO, TRAX
• Gene name: translin associated factor X
• Alternate names: translin-associated protein X, translin-like protein,
• Gene location: 1q42.2 (231528668: 231566523)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may
• OMIM: 602964

Protein Summary

• Protein general information: Q99598  
  • Name: Translin associated protein X (Translin associated factor X)
  • Length: 290  
  • Mass: 33112
• Sequence:

  MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLH
  RITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINK
  QLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVY
  DGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS

• Structural information:
  • Interpro: IPR016069  IPR002848  IPR016068  IPR036081  
  • PDB: 3PJA 3QB5
  • PDBsum: 3PJA 3QB5
  • DIP: 29463
  • STRING: ENSP00000355599
• Other Databases: GeneCards:  TSNAX  Malacards:  TSNAX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004521	endoribonuclease activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0030422	production of siRNA involved in RNA interference	TAS	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0031687	A2A adenosine receptor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881