• Gene id: 7252

Gene Summary

• Gene Symbol: TSHB   Gene   UCSC   Ensembl
• Aliases: TSH-B, TSH-BETA
• Gene name: thyroid stimulating hormone subunit beta
• Alternate names: thyrotropin subunit beta, thyroid stimulating hormone beta, thyrotropin beta chain,
• Gene location: 1p13.2 (115029825: 115035934)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The a
• OMIM: 188540

Protein Summary

• Protein general information: P01222  
  • Name: Thyrotropin subunit beta (Thyroid stimulating hormone subunit beta) (TSH B) (TSH beta) (Thyrotropin beta chain) (Thyrotropin alfa)
  • Length: 138  
  • Mass: 15639
• Sequence:

  MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYR
  DFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV

• Structural information:
  • Interpro: IPR029034  IPR006208  IPR001545  IPR018245  
  • Prosite: PS00261 PS00689
  • CDD: cd00069
  • STRING: ENSP00000256592
• Other Databases: GeneCards:  TSHB  Malacards:  TSHB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005179	hormone activity	IBA	contributes to
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016486	peptide hormone processing	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0043627	response to estrogen	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:0033189	response to vitamin A	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa04918	Thyroid hormone synthesis
hsa04923	Regulation of lipolysis in adipocytes
hsa05320	Autoimmune thyroid disease

Diseases

Associated diseases	References
Congenital nongoitrous hypothyroidism	KEGG:H00250
Isolated TSH deficiency	KEGG:H01699
Congenital nongoitrous hypothyroidism	KEGG:H00250
Isolated TSH deficiency	KEGG:H01699
Hypothyroidism	PMID:1971148
Hyperglycemia	PMID:7956715
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R