• Gene id: 7251

Gene Summary

• Gene Symbol: TSG101   Gene   UCSC   Ensembl
• Aliases: TSG10, VPS23
• Gene name: tumor susceptibility 101
• Alternate names: tumor susceptibility gene 101 protein, ESCRT-I complex subunit TSG101, tumor susceptibility gene 10, tumor susceptibility gene 101, tumor susceptibility protein,
• Gene location: 11p15.1 (64230606: 64224193)     Exons: 3     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The
• OMIM: 601387

Protein Summary

• Protein general information: Q99816  
  • Name: Tumor susceptibility gene 101 protein (ESCRT I complex subunit TSG101)
  • Length: 390  
  • Mass: 43944
  • Tissue specificity: Heart, brain, placenta, lung, liver, skeletal, kidney and pancreas.
• Sequence:

  MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLW
  LLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASY
  PPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDT
  IRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSS
  ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRA
  LMQKARKTAGLSDLY

• Structural information:
  • Protein Domains: (2..14-)
    (/note="UEV-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00652-)
    (322..39-)
    (/note="SB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00644"-)
  • Interpro: IPR037202  IPR017916  IPR016135  IPR008883  
  • Prosite: PS51312 PS51322
  • PDB: 1KPP 1KPQ 1M4P 1M4Q 1S1Q 2F0R 3IV1 3OBQ 3OBS 3OBU 3OBX 3P9G 3P9H 4EJE 4YC1 4ZNY 5VKG
  • PDBsum: 1KPP 1KPQ 1M4P 1M4Q 1S1Q 2F0R 3IV1 3OBQ 3OBS 3OBU 3OBX 3P9G 3P9H 4EJE 4YC1 4ZNY 5VKG
  • DIP: 31809
  • STRING: ENSP00000251968
• Other Databases: GeneCards:  TSG101  Malacards:  TSG101

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000813	ESCRT I complex	TAS	cellular component
GO:0000813	ESCRT I complex	TAS	cellular component
GO:0036258	multivesicular body assembly	TAS	biological process
GO:0097352	autophagosome maturation	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0039702	viral budding via host ESCRT complex	TAS	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IDA	biological process
GO:0005771	multivesicular body	TAS	cellular component
GO:0043130	ubiquitin binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000813	ESCRT I complex	IDA	cellular component
GO:0006858	extracellular transport	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006464	cellular protein modification process	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0016197	endosomal transport	TAS	biological process
GO:0019058	viral life cycle	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030374	nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0010008	endosome membrane	IEA	cellular component
GO:0006513	protein monoubiquitination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0030216	keratinocyte differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0008333	endosome to lysosome transport	IEA	biological process
GO:2000397	positive regulation of ubiquitin-dependent endocytosis	IEA	biological process
GO:1990182	exosomal secretion	IEA	biological process
GO:0070062	extracellular exosome	IEA	cellular component
GO:0046755	viral budding	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0007050	cell cycle arrest	IEA	biological process
GO:0001558	regulation of cell growth	IEA	biological process
GO:0046755	viral budding	IMP	biological process
GO:0005770	late endosome	IMP	cellular component
GO:0090543	Flemming body	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043657	host cell	IEA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000813	ESCRT I complex	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IC	biological process
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0005769	early endosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000813	ESCRT I complex	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0000813	ESCRT I complex	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0046790	virion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:1903551	regulation of extracellular exosome assembly	IMP	biological process
GO:1903543	positive regulation of exosomal secretion	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0046755	viral budding	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0046755	viral budding	IMP	biological process
GO:1903543	positive regulation of exosomal secretion	IMP	biological process
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902186	regulation of viral release from host cell	IMP	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902188	positive regulation of viral release from host cell	IMP	biological process
GO:1902188	positive regulation of viral release from host cell	IMP	biological process
GO:1903774	positive regulation of viral budding via host ESCRT complex	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043405	regulation of MAP kinase activity	IMP	biological process
GO:1903774	positive regulation of viral budding via host ESCRT complex	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Prostate cancer	PMID:9444960
Breast cancer	PMID:17369844
Breast cancer	PMID:10930114
Breast cancer	PMID:10618725
Ovarian cancer	PMID:17606716
Endometrial adenocarcinoma	PMID:10027311
Cervix carcinoma	PMID:10505033
Cervix carcinoma	PMID:10600297
Breast carcinoma	PMID:9019400
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray