• Gene id: 725

Gene Summary

• Gene Symbol: C4BPB   Gene   UCSC   Ensembl
• Aliases: C4BP
• Gene name: complement component 4 binding protein beta
• Alternate names: C4b-binding protein beta chain,
• Gene location: 1q32.1 (83012297: 82988296)     Exons: 11     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into t
• OMIM: 120831

Protein Summary

• Protein general information: P20851  
  • Name: C4b binding protein beta chain
  • Length: 252  
  • Mass: 28357
• Sequence:

  MFFWCACCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTE
  CRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDPPGNPVHGYF
  EGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQESKNLCEAMENFMQQ
  LKESGMTMEELKYSLELKKAELKAKLL

• Structural information:
  • Protein Domains: (21..7-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (79..13-)
    (/note="Sushi-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (137..19-)
    (/note="Sushi-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302"-)
  • Interpro: IPR035976  IPR000436  
  • Prosite: PS50923
  • CDD: cd00033
  • STRING: ENSP00000243611
• Other Databases: GeneCards:  C4BPB  Malacards:  C4BPB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030449	regulation of complement activation	TAS	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0045732	positive regulation of protein catabolic process	IDA	biological process
GO:1903027	regulation of opsonization	IDA	biological process
GO:0045959	negative regulation of complement activation, classical pathway	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0009609	response to symbiotic bacterium	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04610	Complement and coagulation cascades
hsa05133	Pertussis

Diseases

Associated diseases	References
Complement regulatory protein defects	KEGG:H00106
Complement regulatory protein defects	KEGG:H00106
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray