• Gene id: 7226

Gene Summary

• Gene Symbol: TRPM2   Gene   UCSC   Ensembl
• Aliases: EREG1, KNP3, LTRPC2, LTrpC-2, NUDT9H, NUDT9L1, TRPC7
• Gene name: transient receptor potential cation channel subfamily M member 2
• Alternate names: transient receptor potential cation channel subfamily M member 2, estrogen-responsive element-associated gene 1 protein, long transient receptor potential channel 2, transient receptor potential channel 7, transient receptor potential melastatin 2,
• Gene location: 21q22.3 (44350111: 44443080)     Exons: 35     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene forms a tetrameric cation channel that is permeable to calcium, sodium, and potassium and is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to ce

Protein Summary

• Protein general information: O94759  
  • Name: Transient receptor potential cation channel subfamily M member 2 (Estrogen responsive element associated gene 1 protein) (Long transient receptor potential channel 2) (LTrpC 2) (LTrpC2) (Transient receptor potential channel 7) (TrpC7) (Transient receptor
  • Length: 1503  
  • Mass: 171198
  • Tissue specificity: Highly expressed in brain and peripheral blood cells, such as neutrophils. Also detected in bone marrow, spleen, heart, liver and lung. Isoform 2 is found in neutrophil granulocytes. {ECO
• Sequence:

  MEPSALRKAGSEQEEGFEGLPRRVTDLGMVSNLRRSNSSLFKSWRLQCPFGNNDKQESLSSWIPENIKKKECVYF
  VESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQEMPTDAFGDIVFTGLSQKVKKYVRVSQDTP
  SSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDF
  SLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP
  LRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVSDIT
  ISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHE
  NWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYEN
  LDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKLNVQ
  GVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEEDTDSSEEM
  LALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVD
  NGLWRVTLCMLAFPLLLTGLISFREKRLQDVGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVP
  SWCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPGRVILS
  LDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVDWLFRGAVYHSY
  LTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNY
  TFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPPFILLSHLQLFIKRVVLKTPAKRHKQLKNKLEKNEEAALLSWE
  IYLKENYLQNRQFQQKQRPEQKIEDISNKVDAMVDLLDLDPLKRSGSMEQRLASLEEQVAQTAQALHWIVRTLRA
  SGFSSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNEKVPWETEFLIYDPPF
  YTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQAGLPLNPMGRTGLRGRGSLSCFGPNHTLYP
  MVTRWRRNEDGAICRKSIKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVY
  KGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQKAAAEFG
  AHY

• Structural information:
  • Protein Domains: (1354..149-)
    (/note="Nudix-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00794"-)
  • Interpro: IPR005821  IPR015797  IPR000086  IPR029594  IPR041491  
  • Prosite: PS51462
  • PDB: 6MIX 6MIZ 6MJ2 6PUO 6PUR 6PUS 6PUU
  • PDBsum: 6MIX 6MIZ 6MJ2 6PUO 6PUR 6PUS 6PUU
  • STRING: ENSP00000381023
• Other Databases: GeneCards:  TRPM2  Malacards:  TRPM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IDA	cellular component
GO:0047631	ADP-ribose diphosphatase activity	IDA	NOT|molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0070301	cellular response to hydrogen peroxide	IDA	biological process
GO:0099604	ligand-gated calcium channel activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0072571	mono-ADP-D-ribose binding	IDA	molecular function
GO:0099604	ligand-gated calcium channel activity	IDA	molecular function
GO:0005261	cation channel activity	IMP	molecular function
GO:0071577	zinc ion transmembrane transport	IMP	biological process
GO:0051489	regulation of filopodium assembly	IMP	biological process
GO:0071277	cellular response to calcium ion	IMP	biological process
GO:0005509	calcium ion binding	IMP	molecular function
GO:0016787	hydrolase activity	IMP	NOT|molecular function
GO:0030659	cytoplasmic vesicle membrane	ISS	cellular component
GO:0005765	lysosomal membrane	ISS	cellular component
GO:0035584	calcium-mediated signaling using intracellular calcium source	ISS	biological process
GO:0015278	calcium-release channel activity	IMP	molecular function
GO:0051209	release of sequestered calcium ion into cytosol	IMP	biological process
GO:0097553	calcium ion transmembrane import into cytosol	IMP	biological process
GO:2000249	regulation of actin cytoskeleton reorganization	IMP	biological process
GO:0014074	response to purine-containing compound	IMP	biological process
GO:0097553	calcium ion transmembrane import into cytosol	IMP	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0098703	calcium ion import across plasma membrane	ISS	biological process
GO:0097028	dendritic cell differentiation	ISS	biological process
GO:0071502	cellular response to temperature stimulus	ISS	biological process
GO:0071415	cellular response to purine-containing compound	ISS	biological process
GO:0051209	release of sequestered calcium ion into cytosol	ISS	biological process
GO:0002407	dendritic cell chemotaxis	ISS	biological process
GO:0001659	temperature homeostasis	ISS	biological process
GO:0005261	cation channel activity	IEA	molecular function
GO:0006812	cation transport	IEA	biological process
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005272	sodium channel activity	IEA	molecular function
GO:0005262	calcium channel activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005262	calcium channel activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006816	calcium ion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070588	calcium ion transmembrane transport	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0099604	ligand-gated calcium channel activity	IDA	molecular function
GO:0099604	ligand-gated calcium channel activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0099604	ligand-gated calcium channel activity	IDA	molecular function
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0099604	ligand-gated calcium channel activity	IDA	molecular function
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway
hsa04921	Oxytocin signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq