• Gene id: 7224

Gene Summary

• Gene Symbol: TRPC5   Gene   UCSC   Ensembl
• Aliases: PPP1R159, TRP5
• Gene name: transient receptor potential cation channel subfamily C member 5
• Alternate names: short transient receptor potential channel 5, TRP-5, hTRP5, protein phosphatase 1, regulatory subunit 159, transient receptor potential channel 5, transient receptor protein 5,
• Gene location: Xq23 (112082942: 111774313)     Exons: 12     NC_000023.11
• Gene summary(Entrez): This gene belongs to the transient receptor family. It encodes one of the seven mammalian TRPC (transient receptor potential channel) proteins. The encoded protein is a multi-pass membrane protein and is thought to form a receptor-activated non-selective
• OMIM: 606592

Protein Summary

• Protein general information: Q9UL62  
  • Name: Short transient receptor potential channel 5 (TrpC5) (Transient receptor protein 5) (TRP 5) (hTRP 5) (hTRP5)
  • Length: 973  
  • Mass: 111412
  • Tissue specificity: Expressed in brain with higher levels in fetal brain. Found in cerebellum and occipital pole. {ECO
• Sequence:

  MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALL
  IAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRRPSGEKQVPTLMMDTQFSEFTPDITPIMLAA
  HTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGW
  ELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKE
  FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYL
  TFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATI
  SLKIVAYVKYNGSRPREEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYC
  LVLLAFANGLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFV
  GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGN
  WFNNTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTHEGLTEENFKELKQDI
  SSFRYEVLDLLGNRKHPRSFSTSSTELSQRDDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPLIRTMPRSSGAQG
  KSKAESSSKRSFMGPSLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEIN
  LSEVELGEVQGAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHKWGDGQEEQVTTRL

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR005821  IPR013555   IPR005461  IPR002153  
  • STRING: ENSP00000262839
• Other Databases: GeneCards:  TRPC5  Malacards:  TRPC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034703	cation channel complex	IBA	cellular component
GO:0051480	regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0070679	inositol 1,4,5 trisphosphate binding	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006828	manganese ion transport	IBA	biological process
GO:0015279	store-operated calcium channel activity	IBA	molecular function
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005262	calcium channel activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015279	store-operated calcium channel activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0006816	calcium ion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0070588	calcium ion transmembrane transport	TAS	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0042805	actinin binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0070679	inositol 1,4,5 trisphosphate binding	IEA	molecular function
GO:1902630	regulation of membrane hyperpolarization	IEA	biological process
GO:0051117	ATPase binding	IEA	molecular function
GO:0050774	negative regulation of dendrite morphogenesis	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030276	clathrin binding	IEA	molecular function
GO:0030182	neuron differentiation	IEA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034704	calcium channel complex	IDA	cellular component
GO:0005262	calcium channel activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Dilated cardiomyopathy 1H	PMID:16950785
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881