• Gene id: 7223

Gene Summary

• Gene Symbol: TRPC4   Gene   UCSC   Ensembl
• Aliases: HTRP-4, HTRP4, TRP4
• Gene name: transient receptor potential cation channel subfamily C member 4
• Alternate names: short transient receptor potential channel 4, trp-related protein 4,
• Gene location: 13q13.3 (37869771: 37632062)     Exons: 11     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the canonical subfamily of transient receptor potential cation channels. The encoded protein forms a non-selective calcium-permeable cation channel that is activated by Gq-coupled receptors and tyrosine kinases, and plays a r
• OMIM: 142709

Protein Summary

• Protein general information: Q9UBN4  
  • Name: Short transient receptor potential channel 4 (TrpC4) (Trp related protein 4) (hTrp 4) (hTrp4)
  • Length: 977  
  • Mass: 112101
  • Tissue specificity: Strongly expressed in placenta. Expressed at lower levels in heart, pancreas, kidney and brain. Expressed in endothelial cells. Isoform alpha was found to be the predominant isoform. Isoform beta was not found in pancreas and brain. {E
• Sequence:

  MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALL
  IAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAA
  HTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSW
  ELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEF
  VAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLT
  FLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATIS
  LKIVAFVKYSALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCL
  VLLAFANGLNQLYFYYEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATM
  FGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWT
  HLCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEV
  LGLLRGSKLSTIQSANASKESSNSADSDEKSDSEGNSKDKKKNFSLFDLTTLIHPRSAAIASERHNISNGSALVV
  QEPPREKQRKVNFVTDIKNFGLFHRRSKQNAAEQNANQIFSVSEEVARQQAAGPLERNIQLESRGLASRGDLSIP
  GLSEQCVLVDHRERNTDTLGLQVGKRVCPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTT
  RL

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR005821  IPR013555   IPR005460  IPR002153  
  • Prosite: PS50297 PS50088
  • STRING: ENSP00000369027
• Other Databases: GeneCards:  TRPC4  Malacards:  TRPC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070679	inositol 1,4,5 trisphosphate binding	IBA	molecular function
GO:0051480	regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0034703	cation channel complex	IBA	cellular component
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0015279	store-operated calcium channel activity	IBA	molecular function
GO:0006828	manganese ion transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005262	calcium channel activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015279	store-operated calcium channel activity	TAS	molecular function
GO:0006816	calcium ion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0070588	calcium ion transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005901	caveola	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0070679	inositol 1,4,5 trisphosphate binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0014051	gamma-aminobutyric acid secretion	IEA	biological process
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0045296	cadherin binding	IPI	molecular function
GO:0005911	cell-cell junction	IDA	colocalizes with
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0070509	calcium ion import	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034704	calcium channel complex	IDA	cellular component
GO:0030863	cortical cytoskeleton	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0015279	store-operated calcium channel activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881