• Gene id: 7222

Gene Summary

• Gene Symbol: TRPC3   Gene   UCSC   Ensembl
• Aliases: SCA41, TRP3
• Gene name: transient receptor potential cation channel subfamily C member 3
• Alternate names: short transient receptor potential channel 3, hTrp-3, transient receptor potential cation channel subfamily C member 3 variant c, transient receptor protein 3,
• Gene location: 4q27 (121952059: 121874480)     Exons: 13     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol se
• OMIM: 602345

Protein Summary

• Protein general information: Q13507  
  • Name: Short transient receptor potential channel 3 (TrpC3) (Transient receptor protein 3) (TRP 3) (hTrp 3) (hTrp3)
  • Length: 836  
  • Mass: 96009
  • Tissue specificity: Expressed predominantly in brain and at much lower levels in ovary, colon, small intestine, lung, prostate, placenta and testis.
• Sequence:

  MREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHL
  EVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDIT
  PIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLT
  ALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVHRHKASLSRVKLA
  IKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIAPCSRLGKILRSPFMKFV
  AHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPR
  EYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQII
  SEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNAAFT
  TVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKF
  ARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFIMRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFES
  HSFNSILNQPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLS
  EKLNPSMLRCE

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR005821  IPR013555   IPR005459  IPR002153  
  • Prosite: PS50297
  • PDB: 5ZBG 6CUD 6D7L 6DJS
  • PDBsum: 5ZBG 6CUD 6D7L 6DJS
  • DIP: 34311
  • STRING: ENSP00000368966
• Other Databases: GeneCards:  TRPC3  Malacards:  TRPC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070679	inositol 1,4,5 trisphosphate binding	IBA	molecular function
GO:0051480	regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0034703	cation channel complex	IBA	cellular component
GO:0007338	single fertilization	IBA	biological process
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0015279	store-operated calcium channel activity	IBA	molecular function
GO:0006828	manganese ion transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0051592	response to calcium ion	IDA	biological process
GO:0010524	positive regulation of calcium ion transport into cytosol	IDA	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0033198	response to ATP	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005262	calcium channel activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015279	store-operated calcium channel activity	TAS	molecular function
GO:0005262	calcium channel activity	TAS	molecular function
GO:0007602	phototransduction	TAS	biological process
GO:0006816	calcium ion transport	TAS	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070588	calcium ion transmembrane transport	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070679	inositol 1,4,5 trisphosphate binding	IDA	molecular function
GO:1903244	positive regulation of cardiac muscle hypertrophy in response to stress	IDA	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance
hsa05017	Spinocerebellar ataxia

Diseases

Associated diseases	References
Spinocerebellar ataxia	KEGG:H00063
Spinocerebellar ataxia	KEGG:H00063
Pulmonary hypertension	PMID:15358862
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)