• Gene id: 7220

Gene Summary

• Gene Symbol: TRPC1   Gene   UCSC   Ensembl
• Aliases: HTRP-1, TRP1
• Gene name: transient receptor potential cation channel subfamily C member 1
• Alternate names: short transient receptor potential channel 1, TRP-1, capacitative calcium channel protein Trp1, transient receptor potential canonical 1, transient receptor protein 1,
• Gene location: 3q23 (142724033: 142807887)     Exons: 16     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol se
• OMIM: 306480

Protein Summary

• Protein general information: P48995  
  • Name: Short transient receptor potential channel 1 (TrpC1) (Transient receptor protein 1) (TRP 1)
  • Length: 793  
  • Mass: 91212
  • Tissue specificity: Seems to be ubiquitous.
• Sequence:

  MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDL
  NINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIVKLMERIQ
  NPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPAL
  IMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGL
  LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQ
  FGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDF
  LEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGP
  LQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFS
  LAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDK
  CTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKM
  QSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN

• Structural information:
  • Interpro: IPR002110  IPR036770  IPR005821  IPR013555  IPR005457   IPR002153  
  • DIP: 35698
  • STRING: ENSP00000419313
• Other Databases: GeneCards:  TRPC1  Malacards:  TRPC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0042438	melanin biosynthetic process	IDA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006828	manganese ion transport	IBA	biological process
GO:0015279	store-operated calcium channel activity	IBA	molecular function
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0034703	cation channel complex	IBA	cellular component
GO:0051480	regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0070679	inositol 1,4,5 trisphosphate binding	IBA	molecular function
GO:0005262	calcium channel activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0015279	store-operated calcium channel activity	TAS	molecular function
GO:0005262	calcium channel activity	TAS	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006816	calcium ion transport	TAS	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0005261	cation channel activity	EXP	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070588	calcium ion transmembrane transport	TAS	biological process
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070679	inositol 1,4,5 trisphosphate binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051480	regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0051592	response to calcium ion	IDA	biological process
GO:0051592	response to calcium ion	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0042438	melanin biosynthetic process	IDA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006828	manganese ion transport	IBA	biological process
GO:0015279	store-operated calcium channel activity	IBA	molecular function
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0034703	cation channel complex	IBA	cellular component
GO:0051480	regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0070679	inositol 1,4,5 trisphosphate binding	IBA	molecular function
GO:0005262	calcium channel activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0015279	store-operated calcium channel activity	TAS	molecular function
GO:0005262	calcium channel activity	TAS	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006816	calcium ion transport	TAS	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0005261	cation channel activity	EXP	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070588	calcium ion transmembrane transport	TAS	biological process
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070679	inositol 1,4,5 trisphosphate binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051480	regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0051592	response to calcium ion	IDA	biological process
GO:0051592	response to calcium ion	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance
hsa04724	Glutamatergic synapse
hsa04726	Serotonergic synapse
hsa04972	Pancreatic secretion
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881