• Gene id: 7203

Gene Summary

• Gene Symbol: CCT3   Gene   UCSC   Ensembl
• Aliases: CCT-gamma, CCTG, PIG48, TCP-1-gamma, TRIC5
• Gene name: chaperonin containing TCP1 subunit 3
• Alternate names: T-complex protein 1 subunit gamma, T-complex protein 1, gamma subunit, TCP1 (t-complex-1) ring complex, polypeptide 5, chaperonin containing TCP1, subunit 3 (gamma), hTRiC5,
• Gene location: 1q22 (156338414: 156308960)     Exons: 16     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different p
• OMIM: 600114

Protein Summary

• Protein general information: P49368  
  • Name: T complex protein 1 subunit gamma (TCP 1 gamma) (CCT gamma) (hTRiC5)
  • Length: 545  
  • Mass: 60534
• Sequence:

  MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHP
  AAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSD
  MMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVT
  HPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLA
  QHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTIL
  LRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRT
  LIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSG
  HKKKGDDQSRQGGAPDAGQE

• Structural information:
  • Interpro: IPR012719  IPR017998  IPR002194  IPR002423  IPR027409   IPR027413  IPR027410  
  • Prosite: PS00750 PS00751 PS00995
  • CDD: cd03337
  • PDB: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • PDBsum: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • DIP: 32970
  • STRING: ENSP00000295688
• Other Databases: GeneCards:  CCT3  Malacards:  CCT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005832	chaperonin-containing T-complex	IBA	cellular component
GO:0005832	chaperonin-containing T-complex	IDA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0005856	cytoskeleton	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901998	toxin transport	IEA	biological process
GO:0046931	pore complex assembly	IEA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0005832	chaperonin-containing T-complex	IEA	cellular component
GO:0002199	zona pellucida receptor complex	IEA	cellular component
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0050821	protein stabilization	IMP	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904871	positive regulation of protein localization to Cajal body	HMP	biological process
GO:0005832	chaperonin-containing T-complex	TAS	cellular component
GO:1904874	positive regulation of telomerase RNA localization to Cajal body	HMP	biological process
GO:1904851	positive regulation of establishment of protein localization to telomere	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881