• Gene id: 7200

Gene Summary

• Gene Symbol: TRH   Gene   UCSC   Ensembl
• Aliases: Pro-TRH, TRF
• Gene name: thyrotropin releasing hormone
• Alternate names: thyrotropin releasing hormone, TSH-releasing factor, pro-thyrotropin-releasing hormone, prothyroliberin, protirelin, thyrotropin-releasing factor,
• Gene location: 3q22.1 (129974392: 129977937)     Exons: 3     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-
• OMIM: 613879

Protein Summary

• Protein general information: P20396  
  • Name: Pro thyrotropin releasing hormone (Pro TRH) (Prothyroliberin) [Cleaved into: Thyrotropin releasing hormone (TRH) (Protirelin) (TSH releasing factor) (Thyroliberin) (Thyrotropin releasing factor) (TRF)]
  • Length: 242  
  • Mass: 27,404
• Sequence:

  MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHSASQIF
  QSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPK
  RQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEK
  RQHPGRRAAWVREPLEE

• Structural information:
  • Interpro: IPR008857  
  • STRING: ENSP00000303452
• Other Databases: GeneCards:  TRH  Malacards:  TRH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological process
GO:0001692	histamine metabolic process	IBA	biological process
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007628	adult walking behavior	IEA	biological process
GO:0008437	thyrotropin-releasing hormone activity	IEA	molecular function
GO:0009409	response to cold	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0009755	hormone-mediated signaling pathway	IEA	biological process
GO:0014050	negative regulation of glutamate secretion	IBA	biological process
GO:0014054	positive regulation of gamma-aminobutyric acid secretion	IBA	biological process
GO:0030141	secretory granule	IBA	cellular component
GO:0032024	positive regulation of insulin secretion	IBA	biological process
GO:0042755	eating behavior	IBA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0051412	response to corticosterone	IEA	biological process
GO:2000252	negative regulation of feeding behavior	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001692	histamine metabolic process	IEA	biological process
GO:0001692	histamine metabolic process	IBA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007628	adult walking behavior	IEA	biological process
GO:0008437	thyrotropin-releasing hormone activity	IEA	molecular function
GO:0008437	thyrotropin-releasing hormone activity	TAS	molecular function
GO:0009409	response to cold	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0009755	hormone-mediated signaling pathway	IEA	biological process
GO:0014050	negative regulation of glutamate secretion	IEA	biological process
GO:0014050	negative regulation of glutamate secretion	IBA	biological process
GO:0014054	positive regulation of gamma-aminobutyric acid secretion	IEA	biological process
GO:0014054	positive regulation of gamma-aminobutyric acid secretion	IBA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0030141	secretory granule	IBA	cellular component
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IBA	biological process
GO:0042755	eating behavior	IEA	biological process
GO:0042755	eating behavior	IBA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0051412	response to corticosterone	IEA	biological process
GO:2000252	negative regulation of feeding behavior	IEA	biological process
GO:0001692	histamine metabolic process	IBA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008437	thyrotropin-releasing hormone activity	TAS	molecular function
GO:0014050	negative regulation of glutamate secretion	IBA	biological process
GO:0014054	positive regulation of gamma-aminobutyric acid secretion	IBA	biological process
GO:0030141	secretory granule	IBA	cellular component
GO:0032024	positive regulation of insulin secretion	IBA	biological process
GO:0042755	eating behavior	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Arterial hypertension	GAD: 17137217
Blood pressure	GAD: 17137217
Thyrotropin-releasing hormone deficiency	OMIM: 613879
Bone diseases	GAD: 19453261
Psychological disorders	GAD: 19086053
Teratozoospermia	MIK: 15380924
Necrozoospermia	MIK: 15380924
Asthenozoospermia	MIK: 15380924
Bulimia	GAD: 20468064
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 15380924
Necrozoospermia	MIK: 15380924
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15380924	Astenozoospermia, necrozoospermia and teratozoospermia				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881