• Gene id: 719

Gene Summary

• Gene Symbol: C3AR1   Gene   UCSC   Ensembl
• Aliases: AZ3B, C3AR, HNFAG09
• Gene name: complement C3a receptor 1
• Alternate names: C3a anaphylatoxin chemotactic receptor, complement component 3 receptor 1, complement component 3a receptor 1,
• Gene location: 12p13.31 (8066358: 8056843)     Exons: 2     NC_000012.12
• Gene summary(Entrez): C3a is an anaphylatoxin released during activation of the complement system. The protein encoded by this gene is an orphan G protein-coupled receptor for C3a. Binding of C3a by the encoded receptor activates chemotaxis, granule enzyme release, superoxide
• OMIM: 604397

SNPs

rs587777031

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000010.11   g.119030032_119030034CTC[1]
NC_000010.11   g.119030032_119030034CTC[3]
NC_000010.11   g.119030032_119030034CTC[5]
NC_000010.10   g.120789544_120789546CTC[1]
NC_000010.10   g.120789544_120789546CTC[3]
NC_000010.10   g.120789544_120789546CTC[5]
NG_0  

rs16937456

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000008.11   g.71165720A>G
NC_000008.11   g.71165720A>T
NC_000008.10   g.72077955A>G
NC_000008.10   g.72077955A>T|SEQ=[A/G/T]|GENE=LOC105375894

rs36065902

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.41841870A>T
NW_003571052.1   g.128512A>T
NG_051246.1   g.11186A>T
NM_152467.5   c.242A>T
NM_152467.4   c.242A>T
NM_152467.3   c.242A>T
NM_001329596.2   c.-23A>T
NM_001329596.1   c.-23A>T
NM_001329595.1   c.242A>T
NC_000017.10   g.39998122A>T
NP_689680.2  

rs61752339

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.41845328T>C
NW_003571052.1   g.131970T>C
NG_051246.1   g.14644T>C
NM_152467.5   c.887T>C
NM_152467.4   c.887T>C
NM_152467.3   c.887T>C
NM_001329596.2   c.623T>C
NM_001329596.1   c.623T>C
NM_001329595.1   c.887T>C
NC_000017.10   g.40001580T>C
NP_689680.2  

rs79170274

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.119030036T>A
NC_000010.11   g.119030036T>C
NC_000010.10   g.120789548T>A
NC_000010.10   g.120789548T>C
NG_050764.1   g.5321T>A
NG_050764.1   g.5321T>C
NM_199461.4   c.235T>A
NM_199461.4   c.235T>C
NM_199461.3   c.235T>A
NM_199461.3   c.235T>C
NM_199461.  

Protein Summary

• Protein general information: Q16581  
  • Name: C3a anaphylatoxin chemotactic receptor (C3AR) (C3a R)
  • Length: 482  
  • Mass: 53864
  • Tissue specificity: Widely expressed in several differentiated hematopoietic cell lines, in the lung, spleen, ovary, placenta, small intestine, throughout the brain, heart, and endothelial cells. Mostly expressed in lymphoid tissues.
• Sequence:

  MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSL
  PFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVA
  FVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTV
  PTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSA
  SSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKT
  FRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSI
  QGILEAAFSEELTRSTHCPSNNVISERNSTTV

• Structural information:
  • Interpro: IPR001644  IPR002234  IPR000826  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000302079
• Other Databases: GeneCards:  C3AR1  Malacards:  C3AR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004876	complement component C3a receptor activity	IBA	molecular function
GO:0004875	complement receptor activity	IBA	molecular function
GO:0002430	complement receptor mediated signaling pathway	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004875	complement receptor activity	IEA	molecular function
GO:0004876	complement component C3a receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0004876	complement component C3a receptor activity	TAS	molecular function
GO:0004876	complement component C3a receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0008015	blood circulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0030449	regulation of complement activation	TAS	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IEA	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0002430	complement receptor mediated signaling pathway	IDA	biological process
GO:0004876	complement component C3a receptor activity	IDA	molecular function
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	biological process
GO:0004930	G protein-coupled receptor activity	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IPI	molecular function
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	biological process
GO:0004930	G protein-coupled receptor activity	IPI	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004876	complement component C3a receptor activity	IBA	molecular function
GO:0004875	complement receptor activity	IBA	molecular function
GO:0002430	complement receptor mediated signaling pathway	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004875	complement receptor activity	IEA	molecular function
GO:0004876	complement component C3a receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0004876	complement component C3a receptor activity	TAS	molecular function
GO:0004876	complement component C3a receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0008015	blood circulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0030449	regulation of complement activation	TAS	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IEA	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0002430	complement receptor mediated signaling pathway	IDA	biological process
GO:0004876	complement component C3a receptor activity	IDA	molecular function
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	biological process
GO:0004930	G protein-coupled receptor activity	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IPI	molecular function
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	biological process
GO:0004930	G protein-coupled receptor activity	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05150	Staphylococcus aureus infection
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Asthma	PMID:15940127
Asthma	PMID:15278436
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881