• Gene id: 7187

Gene Summary

• Gene Symbol: TRAF3   Gene   UCSC   Ensembl
• Aliases: CAP-1, CAP1, CD40bp, CRAF1, IIAE5, LAP1, RNF118
• Gene name: TNF receptor associated factor 3
• Alternate names: TNF receptor-associated factor 3, CD40 associated protein 1, CD40 binding protein, CD40 receptor associated factor 1, LMP1-associated protein 1, RING-type E3 ubiquitin transferase TRAF3,
• Gene location: 14q32.32 (102777448: 102911499)     Exons: 15     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in
• OMIM: 601896

Protein Summary

• Protein general information: Q13114  
  • Name: TNF receptor associated factor 3 (EC 2.3.2.27) (CAP 1) (CD40 receptor associated factor 1) (CRAF1) (CD40 binding protein) (CD40BP) (LMP1 associated protein 1) (LAP1) (RING type E3 ubiquitin transferase TRAF3)
  • Length: 568  
  • Mass: 64490
• Sequence:

  MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCES
  CMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVR
  PDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSEC
  VNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
  EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVA
  RNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYF
  GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPT
  GEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP

• Structural information:
  • Protein Domains: (415..56-)
    (/note="MATH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00129"-)
  • Interpro: IPR002083  IPR012227  IPR008974  IPR027128  IPR037304   IPR001841  IPR013083  IPR017907  IPR001293  
  • Prosite: PS50144 PS00518 PS50089 PS50145
  • CDD: cd03777
  • PDB: 1FLK 1FLL 1KZZ 1L0A 1RF3 1ZMS 2ECY 2GKW
  • PDBsum: 1FLK 1FLL 1KZZ 1L0A 1RF3 1ZMS 2ECY 2GKW
  • DIP: 6222
  • STRING: ENSP00000454207
• Other Databases: GeneCards:  TRAF3  Malacards:  TRAF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0070534	protein K63-linked ubiquitination	IBA	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IBA	biological process
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0009898	cytoplasmic side of plasma membrane	IBA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IBA	molecular function
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0005164	tumor necrosis factor receptor binding	IBA	molecular function
GO:0033209	tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0032648	regulation of interferon-beta production	ISS	biological process
GO:0001817	regulation of cytokine production	ISS	biological process
GO:0050688	regulation of defense response to virus	ISS	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0030162	regulation of proteolysis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002224	toll-like receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001817	regulation of cytokine production	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0008063	Toll signaling pathway	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0033209	tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0050688	regulation of defense response to virus	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050688	regulation of defense response to virus	IEA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0030162	regulation of proteolysis	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0035631	CD40 receptor complex	IEA	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0032648	regulation of interferon-beta production	IEA	biological process
GO:0009898	cytoplasmic side of plasma membrane	IEA	cellular component
GO:0001817	regulation of cytokine production	IEA	biological process
GO:0009898	cytoplasmic side of plasma membrane	ISS	cellular component
GO:0035631	CD40 receptor complex	ISS	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031996	thioesterase binding	IPI	molecular function
GO:0005164	tumor necrosis factor receptor binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05168	Herpes simplex virus 1 infection
hsa05165	Human papillomavirus infection
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05162	Measles
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa05222	Small cell lung cancer
hsa04657	IL-17 signaling pathway
hsa04622	RIG-I-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray