• Gene id: 7184

Gene Summary

• Gene Symbol: HSP90B1   Gene   UCSC   Ensembl
• Aliases: ECGP, GP96, GRP94, HEL-S-125m, HEL35, TRA1
• Gene name: heat shock protein 90 beta family member 1
• Alternate names: endoplasmin, 94 kDa glucose-regulated protein, endothelial cell (HBMEC) glycoprotein, epididymis luminal protein 35, epididymis secretory sperm binding protein Li 125m, heat shock protein 90 kDa beta member 1, heat shock protein 90kDa beta (Grp94), member 1, hea,
• Gene location: 12q23.3 (103930409: 103947925)     Exons: 18     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this
• OMIM: 191175

Protein Summary

• Protein general information: P14625  
  • Name: Endoplasmin (94 kDa glucose regulated protein) (GRP 94) (Heat shock protein 90 kDa beta member 1) (Tumor rejection antigen 1) (gp96 homolog)
  • Length: 803  
  • Mass: 92469
• Sequence:

  MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK
  FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDT
  GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWES
  DSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
  EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHF
  TAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRET
  LQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLD
  QYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
  SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDIST
  NYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNID
  PDAKVEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL

• Structural information:
  • Interpro: IPR003594  IPR036890  IPR019805  IPR037196  IPR001404   IPR020575  IPR020568  
  • Prosite: PS00014 PS00298
  • PDB: 4NH9
  • PDBsum: 4NH9
  • DIP: 36060
  • STRING: ENSP00000299767
• Other Databases: GeneCards:  HSP90B1  Malacards:  HSP90B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034975	protein folding in endoplasmic reticulum	TAS	biological process
GO:0034976	response to endoplasmic reticulum stress	TAS	biological process
GO:0030970	retrograde protein transport, ER to cytosol	IMP	biological process
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0048471	perinuclear region of cytoplasm	IBA	cellular component
GO:0006457	protein folding	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0071318	cellular response to ATP	IDA	biological process
GO:0031247	actin rod assembly	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0050750	low-density lipoprotein particle receptor binding	IDA	molecular function
GO:0043666	regulation of phosphoprotein phosphatase activity	IDA	biological process
GO:0019903	protein phosphatase binding	IDA	molecular function
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0071682	endocytic vesicle lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0036500	ATF6-mediated unfolded protein response	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034663	endoplasmic reticulum chaperone complex	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0033018	sarcoplasmic reticulum lumen	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0001666	response to hypoxia	IDA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051208	sequestering of calcium ion	NAS	biological process
GO:0015031	protein transport	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05132	Salmonella infection
hsa04141	Protein processing in endoplasmic reticulum
hsa05418	Fluid shear stress and atherosclerosis
hsa04915	Estrogen signaling pathway
hsa04657	IL-17 signaling pathway
hsa04918	Thyroid hormone synthesis
hsa05215	Prostate cancer

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)