• Gene id: 718

Gene Summary

• Gene Symbol: C3   Gene   UCSC   Ensembl
• Aliases: AHUS5, ARMD9, ASP, C3a, C3b, CPAMD1, HEL-S-62p
• Gene name: complement C3
• Alternate names: complement C3, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, C3a anaphylatoxin, acylation-stimulating protein cleavage product, complement component 3, complement component C3a, complement component C3b, epididymis secretory sperm bin,
• Gene location: 19p13.3 (6720681: 6677834)     Exons: 41     NC_000019.10
• Gene summary(Entrez): Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and
• OMIM: 120700

Protein Summary

• Protein general information: P01024  
  • Name: Complement C3 (C3 and PZP like alpha 2 macroglobulin domain containing protein 1) [Cleaved into: Complement C3 beta chain; C3 beta c (C3bc); Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein (ASP) (C3adesArg); Complement C3b alph
  • Length: 1663  
  • Mass: 187,148
• Sequence:

  MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTV
  LTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIF
  TVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK
  EYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEV
  VLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVF
  VTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVG
  NSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDF
  IPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDK
  GVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAARRRRSVQL
  TEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLARSN
  LDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTV
  MQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
  VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTE
  SETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIK
  KGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVI
  HQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
  RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMV
  FQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHA
  KAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGV
  DRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
  KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDE
  VQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLG
  AFTESMVVFGCPN

• Structural information:
  • Protein Domains: Anaphylatoxin-like. (693-728)
    NTR. (1518-1661)
  • Interpro: IPR009048  IPR036595  IPR011626  IPR002890  IPR011625   IPR000020  IPR018081  IPR001840  IPR035711  IPR013783  IPR001599  IPR019742  IPR019565  IPR001134  IPR018933  IPR035815  IPR008930  IPR008993  
  • Prosite: PS00477 PS01177 PS01178 PS50189
  • CDD: cd03583
  • PDB: 1C3D 1GHQ 1W2S 2A73 2A74 2GOX 2I07 2ICE 2ICF 2NOJ 2QKI 2WII 2WIN 2WY7 2WY8 2XQW 2XWB 2XWJ 3D5R 3D5S 3G6J 3L3O 3L5N 3NMS 3OED 3OHX 3OXU 3RJ3 3T4A 4HW5 4HWJ 4I6O 4M76 4ONT 4ZH1 5FO7 5FO8 5FO9 5FOA 5FOB 5M6W 5NBQ 5O32 5O35 6EHG
  • PDBsum: 1C3D 1GHQ 1W2S 2A73 2A74 2GOX 2I07 2ICE 2ICF 2NOJ 2QKI 2WII 2WIN 2WY7 2WY8 2XQW 2XWB 2XWJ 3D5R 3D5S 3G6J 3L3O 3L5N 3NMS 3OED 3OHX 3OXU 3RJ3 3T4A 4HW5 4HWJ 4I6O 4M76 4ONT 4ZH1 5FO7 5FO8 5FO9 5FOA 5FOB 5M6W 5NBQ 5O32 5O35 6EHG
  • DIP: 35180
  • STRING: ENSP00000245907
• Other Databases: GeneCards:  C3  Malacards:  C3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001798	positive regulation of type IIa hypersensitivity	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001970	positive regulation of activation of membrane attack complex	IEA	biological process
GO:0002507	tolerance induction	IEA	biological process
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004866	endopeptidase inhibitor activity	IEA	molecular function
GO:0005102	receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0006956	complement activation	IMP	biological process
GO:0006956	complement activation	TAS	biological process
GO:0006957	complement activation, alternative pathway	TAS	biological process
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0010575	positive regulation of vascular endothelial growth factor production	IDA	biological process
GO:0010828	positive regulation of glucose transport	IDA	biological process
GO:0010828	positive regulation of glucose transport	IDA	biological process
GO:0010866	regulation of triglyceride biosynthetic process	IDA	biological process
GO:0010884	positive regulation of lipid storage	IDA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0030449	regulation of complement activation	TAS	biological process
GO:0031715	C5L2 anaphylatoxin chemotactic receptor binding	IDA	molecular function
GO:0032026	response to magnesium ion	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0045745	positive regulation of G-protein coupled receptor protein signaling pathway	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0048037	cofactor binding	IEA	molecular function
GO:0048639	positive regulation of developmental growth	IEA	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:2000427	positive regulation of apoptotic cell clearance	IMP	biological process
GO:0001798	positive regulation of type IIa hypersensitivity	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001970	positive regulation of activation of membrane attack complex	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002507	tolerance induction	IEA	biological process
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004866	endopeptidase inhibitor activity	IEA	molecular function
GO:0005102	receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0006956	complement activation	IEA	biological process
GO:0006956	complement activation	IEA	biological process
GO:0006956	complement activation	IMP	biological process
GO:0006956	complement activation	TAS	biological process
GO:0006957	complement activation, alternative pathway	IEA	biological process
GO:0006957	complement activation, alternative pathway	TAS	biological process
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0010575	positive regulation of vascular endothelial growth factor production	IDA	biological process
GO:0010828	positive regulation of glucose transport	IDA	biological process
GO:0010828	positive regulation of glucose transport	IDA	biological process
GO:0010866	regulation of triglyceride biosynthetic process	IDA	biological process
GO:0010884	positive regulation of lipid storage	IDA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0030449	regulation of complement activation	TAS	biological process
GO:0031715	C5L2 anaphylatoxin chemotactic receptor binding	IDA	molecular function
GO:0032026	response to magnesium ion	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045745	positive regulation of G-protein coupled receptor protein signaling pathway	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0048037	cofactor binding	IEA	molecular function
GO:0048639	positive regulation of developmental growth	IEA	biological process
GO:0050766	positive regulation of phagocytosis	IEA	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:2000427	positive regulation of apoptotic cell clearance	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005102	receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0006956	complement activation	IMP	biological process
GO:0006956	complement activation	TAS	biological process
GO:0006957	complement activation, alternative pathway	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IDA	biological process
GO:0010828	positive regulation of glucose transport	IDA	biological process
GO:0010828	positive regulation of glucose transport	IDA	biological process
GO:0010866	regulation of triglyceride biosynthetic process	IDA	biological process
GO:0010884	positive regulation of lipid storage	IDA	biological process
GO:0030449	regulation of complement activation	TAS	biological process
GO:0031715	C5L2 anaphylatoxin chemotactic receptor binding	IDA	molecular function
GO:0045745	positive regulation of G-protein coupled receptor protein signaling pathway	IDA	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072562	blood microparticle	IDA	cellular component
GO:2000427	positive regulation of apoptotic cell clearance	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04145	Phagosome
hsa04610	Complement and coagulation cascades
hsa05203	Viral carcinogenesis
hsa05322	Systemic lupus erythematosus
hsa05133	Pertussis
hsa05134	Legionellosis
hsa05150	Staphylococcus aureus infection
hsa05152	Tuberculosis
hsa05168	Herpes simplex virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05140	Leishmaniasis
hsa05142	Chagas disease

Diseases

Associated diseases	References
Cancer (lymphoma)	GAD: 19344414
Cancer (meningeal)	GAD: 20406964
Cancer (ovarian)	GAD: 20628624
Cardiovascular disease	GAD: 18612209
Atherosclerosis	GAD: 19948975
Brain ischemia	GAD: 19131662
Choroidal neovascularization	GAD: 20523265
Macular degeneration	GAD: 18596911
Age-related macular degeneration	KEGG: H00821
Atypical hemolytic uremic syndrome	KEGG: H01434
Asthma	GAD: 15278436
Inflammatory bowel disease	GAD: 16570073
Systemic lupus erythematosus (SLE)	GAD: 19387462
Systemic lupus erythematosus (SLE)	GAD: 11801636
Metabolic syndrome	GAD: 19828715
Alzheimer's disease	GAD: 15648851
Epilepsy	GAD: 20862287
Cirrhosis	GAD: 4029969
Endometriosis	INFBASE: 6208058
Endometriosis-associated infertility	INFBASE: 6208058
Follicular development	INFBASE: 25595538
Polycystic ovary syndrome (PCOS)	INFBASE: 18206145
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 21697218
Polycystic ovary syndrome (PCOS)	INFBASE: 21316661
Ovarian endometriosis	INFBASE: 22633261
Female infertility	INFBASE: 18206145
Male factor infertility	MIK: 10526649
Erythema	GAD: 19225544
Dermatitis	GAD: 18631248
Scar hypertrophy	GAD: 8395174
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 10526649
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
10526649	Male infertility				Male infertility
26791536	Male infertility				Male infertility	caspase-3 (c3) PST
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq