About Us

Search Result


Gene id 718
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol C3   Gene   UCSC   Ensembl
Aliases AHUS5, ARMD9, ASP, C3a, C3b, CPAMD1, HEL-S-62p
Gene name complement C3
Alternate names complement C3, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, C3a anaphylatoxin, acylation-stimulating protein cleavage product, complement component 3, complement component C3a, complement component C3b, epididymis secretory sperm bin,
Gene location 19p13.3 (6720681: 6677834)     Exons: 41     NC_000019.10
Gene summary(Entrez) Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and
OMIM 120700

Protein Summary

Protein general information P01024  

Name: Complement C3 (C3 and PZP like alpha 2 macroglobulin domain containing protein 1) [Cleaved into: Complement C3 beta chain; C3 beta c (C3bc); Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein (ASP) (C3adesArg); Complement C3b alph

Length: 1663  Mass: 187,148

Sequence MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTV
LTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIF
TVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK
EYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEV
VLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVF
VTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVG
NSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDF
IPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDK
GVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAARRRRSVQL
TEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLARSN
LDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTV
MQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTE
SETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIK
KGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVI
HQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMV
FQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHA
KAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGV
DRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDE
VQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLG
AFTESMVVFGCPN
Structural information
Protein Domains
Anaphylatoxin-like. (693-728)
NTR. (1518-1661)
Interpro:  IPR009048  IPR036595  IPR011626  IPR002890  IPR011625  
IPR000020  IPR018081  IPR001840  IPR035711  IPR013783  IPR001599  IPR019742  IPR019565  IPR001134  IPR018933  IPR035815  IPR008930  IPR008993  
Prosite:   PS00477 PS01177 PS01178 PS50189
CDD:   cd03583

PDB:  
1C3D 1GHQ 1W2S 2A73 2A74 2GOX 2I07 2ICE 2ICF 2NOJ 2QKI 2WII 2WIN 2WY7 2WY8 2XQW 2XWB 2XWJ 3D5R 3D5S 3G6J 3L3O 3L5N 3NMS 3OED 3OHX 3OXU 3RJ3 3T4A 4HW5 4HWJ 4I6O 4M76 4ONT 4ZH1 5FO7 5FO8 5FO9 5FOA 5FOB 5M6W 5NBQ 5O32 5O35 6EHG
PDBsum:   1C3D 1GHQ 1W2S 2A73 2A74 2GOX 2I07 2ICE 2ICF 2NOJ 2QKI 2WII 2WIN 2WY7 2WY8 2XQW 2XWB 2XWJ 3D5R 3D5S 3G6J 3L3O 3L5N 3NMS 3OED 3OHX 3OXU 3RJ3 3T4A 4HW5 4HWJ 4I6O 4M76 4ONT 4ZH1 5FO7 5FO8 5FO9 5FOA 5FOB 5M6W 5NBQ 5O32 5O35 6EHG

DIP:  

35180

MINT:  
STRING:   ENSP00000245907
Other Databases GeneCards:  C3  Malacards:  C3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0001798 positive regulation of ty
pe IIa hypersensitivity
IEA biological process
GO:0001934 positive regulation of pr
otein phosphorylation
IDA biological process
GO:0001970 positive regulation of ac
tivation of membrane atta
ck complex
IEA biological process
GO:0002507 tolerance induction
IEA biological process
GO:0004252 serine-type endopeptidase
activity
TAS molecular function
GO:0004252 serine-type endopeptidase
activity
TAS molecular function
GO:0004866 endopeptidase inhibitor a
ctivity
IEA molecular function
GO:0005102 receptor binding
TAS molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0006508 proteolysis
IEA biological process
GO:0006631 fatty acid metabolic proc
ess
IEA biological process
GO:0006954 inflammatory response
IEA biological process
GO:0006955 immune response
TAS biological process
GO:0006956 complement activation
IMP biological process
GO:0006956 complement activation
TAS biological process
GO:0006957 complement activation, al
ternative pathway
TAS biological process
GO:0006958 complement activation, cl
assical pathway
IEA biological process
GO:0007165 signal transduction
TAS biological process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological process
GO:0007596 blood coagulation
IEA biological process
GO:0008289 lipid binding
IEA molecular function
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological process
GO:0010828 positive regulation of gl
ucose transport
IDA biological process
GO:0010828 positive regulation of gl
ucose transport
IDA biological process
GO:0010866 regulation of triglycerid
e biosynthetic process
IDA biological process
GO:0010884 positive regulation of li
pid storage
IDA biological process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological process
GO:0030449 regulation of complement
activation
TAS biological process
GO:0031715 C5L2 anaphylatoxin chemot
actic receptor binding
IDA molecular function
GO:0032026 response to magnesium ion
IEA biological process
GO:0032355 response to estradiol
IEA biological process
GO:0032570 response to progesterone
IEA biological process
GO:0045745 positive regulation of G-
protein coupled receptor
protein signaling pathway
IDA biological process
GO:0045766 positive regulation of an
giogenesis
IEA biological process
GO:0048037 cofactor binding
IEA molecular function
GO:0048639 positive regulation of de
velopmental growth
IEA biological process
GO:0050776 regulation of immune resp
onse
TAS biological process
GO:0051384 response to glucocorticoi
d
IEA biological process
GO:0070062 extracellular exosome
IDA cellular component
GO:0070062 extracellular exosome
IDA cellular component
GO:0070062 extracellular exosome
IDA cellular component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IEA biological process
GO:0072562 blood microparticle
IDA cellular component
GO:2000427 positive regulation of ap
optotic cell clearance
IMP biological process
GO:0001798 positive regulation of ty
pe IIa hypersensitivity
IEA biological process
GO:0001934 positive regulation of pr
otein phosphorylation
IDA biological process
GO:0001970 positive regulation of ac
tivation of membrane atta
ck complex
IEA biological process
GO:0002376 immune system process
IEA biological process
GO:0002507 tolerance induction
IEA biological process
GO:0004252 serine-type endopeptidase
activity
TAS molecular function
GO:0004252 serine-type endopeptidase
activity
TAS molecular function
GO:0004866 endopeptidase inhibitor a
ctivity
IEA molecular function
GO:0005102 receptor binding
TAS molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
IEA cellular component
GO:0005615 extracellular space
IEA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0006508 proteolysis
IEA biological process
GO:0006629 lipid metabolic process
IEA biological process
GO:0006631 fatty acid metabolic proc
ess
IEA biological process
GO:0006954 inflammatory response
IEA biological process
GO:0006954 inflammatory response
IEA biological process
GO:0006955 immune response
TAS biological process
GO:0006956 complement activation
IEA biological process
GO:0006956 complement activation
IEA biological process
GO:0006956 complement activation
IMP biological process
GO:0006956 complement activation
TAS biological process
GO:0006957 complement activation, al
ternative pathway
IEA biological process
GO:0006957 complement activation, al
ternative pathway
TAS biological process
GO:0006958 complement activation, cl
assical pathway
IEA biological process
GO:0007165 signal transduction
TAS biological process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological process
GO:0007596 blood coagulation
IEA biological process
GO:0008289 lipid binding
IEA molecular function
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological process
GO:0010828 positive regulation of gl
ucose transport
IDA biological process
GO:0010828 positive regulation of gl
ucose transport
IDA biological process
GO:0010866 regulation of triglycerid
e biosynthetic process
IDA biological process
GO:0010884 positive regulation of li
pid storage
IDA biological process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological process
GO:0030449 regulation of complement
activation
TAS biological process
GO:0031715 C5L2 anaphylatoxin chemot
actic receptor binding
IDA molecular function
GO:0032026 response to magnesium ion
IEA biological process
GO:0032355 response to estradiol
IEA biological process
GO:0032570 response to progesterone
IEA biological process
GO:0043627 response to estrogen
IEA biological process
GO:0045087 innate immune response
IEA biological process
GO:0045745 positive regulation of G-
protein coupled receptor
protein signaling pathway
IDA biological process
GO:0045766 positive regulation of an
giogenesis
IEA biological process
GO:0048037 cofactor binding
IEA molecular function
GO:0048639 positive regulation of de
velopmental growth
IEA biological process
GO:0050766 positive regulation of ph
agocytosis
IEA biological process
GO:0050776 regulation of immune resp
onse
TAS biological process
GO:0051384 response to glucocorticoi
d
IEA biological process
GO:0070062 extracellular exosome
IDA cellular component
GO:0070062 extracellular exosome
IDA cellular component
GO:0070062 extracellular exosome
IDA cellular component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IEA biological process
GO:0072562 blood microparticle
IDA cellular component
GO:2000427 positive regulation of ap
optotic cell clearance
IMP biological process
GO:0001934 positive regulation of pr
otein phosphorylation
IDA biological process
GO:0004252 serine-type endopeptidase
activity
TAS molecular function
GO:0004252 serine-type endopeptidase
activity
TAS molecular function
GO:0005102 receptor binding
TAS molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0006955 immune response
TAS biological process
GO:0006956 complement activation
IMP biological process
GO:0006956 complement activation
TAS biological process
GO:0006957 complement activation, al
ternative pathway
TAS biological process
GO:0007165 signal transduction
TAS biological process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological process
GO:0010828 positive regulation of gl
ucose transport
IDA biological process
GO:0010828 positive regulation of gl
ucose transport
IDA biological process
GO:0010866 regulation of triglycerid
e biosynthetic process
IDA biological process
GO:0010884 positive regulation of li
pid storage
IDA biological process
GO:0030449 regulation of complement
activation
TAS biological process
GO:0031715 C5L2 anaphylatoxin chemot
actic receptor binding
IDA molecular function
GO:0045745 positive regulation of G-
protein coupled receptor
protein signaling pathway
IDA biological process
GO:0050776 regulation of immune resp
onse
TAS biological process
GO:0070062 extracellular exosome
IDA cellular component
GO:0070062 extracellular exosome
IDA cellular component
GO:0070062 extracellular exosome
IDA cellular component
GO:0072562 blood microparticle
IDA cellular component
GO:2000427 positive regulation of ap
optotic cell clearance
IMP biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04080Neuroactive ligand-receptor interaction
hsa04145Phagosome
hsa04610Complement and coagulation cascades
hsa05203Viral carcinogenesis
hsa05322Systemic lupus erythematosus
hsa05133Pertussis
hsa05134Legionellosis
hsa05150Staphylococcus aureus infection
hsa05152Tuberculosis
hsa05168Herpes simplex virus 1 infection
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa05140Leishmaniasis
hsa05142Chagas disease
Associated diseases References
Cancer (lymphoma) GAD: 19344414
Cancer (meningeal) GAD: 20406964
Cancer (ovarian) GAD: 20628624
Cardiovascular disease GAD: 18612209
Atherosclerosis GAD: 19948975
Brain ischemia GAD: 19131662
Choroidal neovascularization GAD: 20523265
Macular degeneration GAD: 18596911
Age-related macular degeneration KEGG: H00821
Atypical hemolytic uremic syndrome KEGG: H01434
Asthma GAD: 15278436
Inflammatory bowel disease GAD: 16570073
Systemic lupus erythematosus (SLE) GAD: 19387462
Systemic lupus erythematosus (SLE) GAD: 11801636
Metabolic syndrome GAD: 19828715
Alzheimer's disease GAD: 15648851
Epilepsy GAD: 20862287
Cirrhosis GAD: 4029969
Endometriosis INFBASE: 6208058
Endometriosis-associated�infertility INFBASE: 6208058
Follicular development INFBASE: 25595538
Polycystic ovary syndrome (PCOS) INFBASE: 18206145
Ovarian hyperstimulation syndrome (OHSS) INFBASE: 21697218
Polycystic ovary syndrome (PCOS) INFBASE: 21316661
Ovarian endometriosis INFBASE: 22633261
Female infertility INFBASE: 18206145
Male factor infertility MIK: 10526649
Erythema GAD: 19225544
Dermatitis GAD: 18631248
Scar hypertrophy GAD: 8395174
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Male infertility MIK: 10526649
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
10526649 Male infer
tility


Male infertility
Show abstract
26791536 Male infer
tility


Male infertility caspase-3�(c3)
PST
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
29961538 Male facto
r infertil
ity

318 (128 couple
s presenting wi
th OAT (MF) and
118 maternal a
ge-matched cont
rol (no MF) sub
jects undergoin
g infertility t
reatment, 72 su
rplus cryoprese
rved blastocyst
s)
Male infertility RNA-seq
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract