• Gene id: 7179

Gene Summary

• Gene Symbol: TPTE   Gene   UCSC   Ensembl
• Aliases: CT44, PTEN2
• Gene name: transmembrane phosphatase with tensin homology
• Alternate names: putative tyrosine-protein phosphatase TPTE, PTEN-related tyrosine phosphatase, cancer/testis antigen 44, tensin, putative protein-tyrosine phosphatase, tumor antigen BJ-HCC-5,
• Gene location: 21p11.2 (34915710: 34925995)     Exons: 10     NC_000005.10
• Gene summary(Entrez): This gene encodes a PTEN-related tyrosine phosphatase which may play a role in the signal transduction pathways of the endocrine or spermatogenic function of the testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Ma
• OMIM: 604336

Protein Summary

• Protein general information: P56180  
  • Name: Putative tyrosine protein phosphatase TPTE (EC 3.1.3.48) (Cancer/testis antigen 44) (CT44) (Transmembrane phosphatase with tensin homology) (Tumor antigen BJ HCC 5)
  • Length: 551  
  • Mass: 64322
  • Tissue specificity: Exclusively expressed in testis. {ECO
• Sequence:

  MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVLARLSKFEVEDAENVA
  SYDSKIKKIVHSIVSSFAFGLFGVFLVLLDVTLILADLIFTDSKLYIPLEYRSISLAIALFFLMDVLLRVFVERR
  QQYFSDLFNILDTAIIVILLLVDVVYIFFDIKLLRNIPRWTHLLRLLRLIILLRIFHLFHQKRQLEKLIRRRVSE
  NKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVV
  RIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICSTAKESLYYFGERRTD
  KTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFSTISLGK
  CSVLDNITTDKILIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARR
  IYPSDFAVEILFGEKMTSSDVVAGSD

• Structural information:
  • Protein Domains: (228..40-)
    (/note="Phosphatase-tensin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00590-)
    (411..54-)
    (/note="C2-tensin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00589"-)
  • Interpro: IPR000340  IPR029021  IPR014020  IPR029023  IPR016130   IPR027359  
  • Prosite: PS51182 PS51181
  • STRING: ENSP00000484403
• Other Databases: GeneCards:  TPTE  Malacards:  TPTE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016314	phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity	IBA	molecular function
GO:0016311	dephosphorylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 21412036
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray