• Gene id: 7178

Gene Summary

• Gene Symbol: TPT1   Gene   UCSC   Ensembl
• Aliases: HRF, TCTP, p02, p23
• Gene name: tumor protein, translationally-controlled 1
• Alternate names: translationally-controlled tumor protein, fortilin, histamine-releasing factor,
• Gene location: 13q14.13 (45341283: 45333470)     Exons: 6     NC_000013.11
• Gene summary(Entrez): This gene encodes a protein that is a regulator of cellular growth and proliferation. Its mRNA is highly structured and contains an oligopyrimidine tract (5'-TOP) in its 5' untranslated region that functions to repress its translation under quiescent cond

Protein Summary

• Protein general information: P13693  
  • Name: Translationally controlled tumor protein (TCTP) (Fortilin) (Histamine releasing factor) (HRF) (p23)
  • Length: 172  
  • Mass: 19595
  • Tissue specificity: Found in several healthy and tumoral cells including erythrocytes, hepatocytes, macrophages, platelets, keratinocytes, erythroleukemia cells, gliomas, melanomas, hepatoblastomas, and lymphomas. It cannot be detected in kidney and renal
• Sequence:

  MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMN
  HHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLD
  YREDGVTPYMIFFKDGLEMEKC

• Structural information:
  • Protein Domains: (1..17-)
    (/note="TCTP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01133"-)
  • Interpro: IPR011057  IPR011323  IPR034737  IPR018103  IPR018105  
  • Prosite: PS01002 PS01003 PS51797
  • PDB: 1YZ1 2HR9 3EBM 4Z9V 5O9L 5O9M 6IZB 6IZE
  • PDBsum: 1YZ1 2HR9 3EBM 4Z9V 5O9L 5O9M 6IZB 6IZE
  • DIP: 40097
  • STRING: ENSP00000477781
• Other Databases: GeneCards:  TPT1  Malacards:  TPT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005771	multivesicular body	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0000922	spindle pole	IDA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0006874	cellular calcium ion homeostasis	IC	biological process
GO:0006816	calcium ion transport	IC	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0009615	response to virus	IEP	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0042981	regulation of apoptotic process	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Oligozoospermia	MIK: 21989496

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
21989496	Oligozoospermia			11 (8 infertile and 3 fertile men)	Male infertility	Microarray