• Gene id: 7177

Gene Summary

• Gene Symbol: TPSAB1   Gene   UCSC   Ensembl
• Aliases: TPS1, TPS2, TPSB1, TPSB2, Tryptase-2
• Gene name: tryptase alpha/beta 1
• Alternate names: tryptase alpha/beta-1, Tryptase II, Tryptase beta-2, epididymis secretory sperm binding protein, mast cell alpha II tryptase, mast cell beta I tryptase, tryptase alpha II, tryptase alpha-1, tryptase beta I, tryptase beta-1, tryptase-1, tryptase-I, tryptase-III,
• Gene location: 16p13.3 (1240704: 1242553)     Exons: 6     NC_000016.10
• Gene summary(Entrez): Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes ar
• OMIM: 191080

Protein Summary

• Protein general information: Q15661  
  • Name: Tryptase alpha/beta 1 (Tryptase 1) (EC 3.4.21.59) (Tryptase I) (Tryptase alpha 1)
  • Length: 275  
  • Mass: 30515
  • Tissue specificity: Isoform 1 and isoform 2 are expressed in lung, stomach, spleen, heart and skin; in these tissues, isoform 1 is predominant. Isoform 2 is expressed in aorta, spleen, and breast tumor, with highest levels in the endothelial cells of some
• Sequence:

  MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHC
  VGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFP
  PGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSG
  GPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

• Structural information:
  • Protein Domains: (31..27-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 1LTO 2F9N 2F9O 2F9P 2ZEB 2ZEC 4A6L 4MPU 4MPV 4MPW 4MPX 4MQA 5F03 5WI6 6O1F
  • PDBsum: 1LTO 2F9N 2F9O 2F9P 2ZEB 2ZEC 4A6L 4MPU 4MPV 4MPW 4MPX 4MQA 5F03 5WI6 6O1F
  • STRING: ENSP00000343577
• Other Databases: GeneCards:  TPSAB1  Malacards:  TPSAB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	TAS	molecular function
GO:0006952	defense response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0022617	extracellular matrix disassembly	IDA	biological process
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0004252	serine-type endopeptidase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)