• Gene id: 7175

Gene Summary

• Gene Symbol: TPR   Gene   UCSC   Ensembl
• Gene name: translocated promoter region, nuclear basket protein
• Alternate names: nucleoprotein TPR, NPC-associated intranuclear protein, megator, nuclear pore complex-associated protein TPR, translocated promoter region (to activated MET oncogene), translocated promoter region protein, tumor potentiating region,
• Gene location: 1q31.1 (186375252: 186311651)     Exons: 51     NC_000001.11
• Gene summary(Entrez): This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRN
• OMIM: 189940

Protein Summary

• Protein general information: P12270  
  • Name: Nucleoprotein TPR (Megator) (NPC associated intranuclear protein) (Translocated promoter region protein)
  • Length: 2363  
  • Mass: 267293
  • Tissue specificity: Expressed in esophagus, ovary, liver, skin, smooth muscles, cerebrum and fetal cerebellum (at protein level). Highest in testis, lung, thymus, spleen and brain, lower levels in heart, liver and kidney. {ECO
• Sequence:

  MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETREC
  QSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEELEAEKRDLIRTNERLSQELEYLTEDVKRLNE
  KLKESNTTKGELQLKLDELQASDVSVKYREKRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCN
  LENKKEEVSRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS
  NELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLEKELENANDLLSATKRKGAILSEEEL
  AAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKA
  VASLSVKLEQAMKEIQRLQEDTDKANKQSSVLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSAD
  ISSSSEVISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQ
  MQLVDSIVRQRDMYRILLSQTTGVAIPLHASSLDDVSLASTPKRPSTSQTVSTPAPVPVIESTEAIEAKAALKQL
  QEIFENYKKEKAENEKIQNEQLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLT
  ATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGI
  LERSETETKQRLSSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKE
  IATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTSNVEQYQAMVTSLEES
  LNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEA
  LQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLL
  ECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEIL
  RFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVVMET
  NKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEKKLLEEDVKRWKARNQHLVSQQKDPD
  TEEYRKLLSEKEVHTKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIIDIQ
  EKVKTITQVKKIGRRYKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENL
  QKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAAKSKIAHLAGVKDQLT
  KENEELKQRNGALDQQKDELDVRITALKSQYEGRISRLERELREHQERHLEQRDEPQEPSNKVPEQQRQITLKTT
  PASGERGIASTSDPPTANIKPTPVVSTPSKVTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVES
  QEAMQSEGPVEHVPVFGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSSNIVEV
  VQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLKSVTPVGTEEEVMAEE
  STDGEVETQVYNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDLGPLQSDQQTTTSSQDGQGKGDDVIVIDSDD
  EEEDDDENDGEHEDYEEDEEDDDDDEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGG
  EGNHRAADSQNSGEGNTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR
  IQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAGVPRFRFGPPEDMPQT
  SSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAAPVTVFTESTTSDASEHASQSVPMVTTSTGT
  LSTTNETATGDDGDEVFVEAESEGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRR
  VRLQTTLRQGVRGRQFNRQRGVSHAMGGRGGINRGNIN

• Structural information:
  • Interpro: IPR012929  
  • PDB: 5TO5 5TO6 5TO7 5TVB
  • PDBsum: 5TO5 5TO6 5TO7 5TVB
  • DIP: 50405
  • STRING: ENSP00000356448
• Other Databases: GeneCards:  TPR  Malacards:  TPR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901673	regulation of mitotic spindle assembly	IBA	biological process
GO:0017056	structural constituent of nuclear pore	IBA	molecular function
GO:0005643	nuclear pore	IBA	cellular component
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0051019	mitogen-activated protein kinase binding	IDA	molecular function
GO:0046832	negative regulation of RNA export from nucleus	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0034605	cellular response to heat	IDA	biological process
GO:0034399	nuclear periphery	IDA	cellular component
GO:0034399	nuclear periphery	IDA	cellular component
GO:0034399	nuclear periphery	IDA	cellular component
GO:0034399	nuclear periphery	IDA	cellular component
GO:0034399	nuclear periphery	IDA	cellular component
GO:0034399	nuclear periphery	IDA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0015631	tubulin binding	IDA	molecular function
GO:0005868	cytoplasmic dynein complex	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0017056	structural constituent of nuclear pore	IDA	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0000776	kinetochore	IDA	cellular component
GO:0000776	kinetochore	IDA	NOT|cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0070849	response to epidermal growth factor	IDA	biological process
GO:0070840	dynein complex binding	IDA	molecular function
GO:0044615	nuclear pore nuclear basket	IDA	cellular component
GO:0044615	nuclear pore nuclear basket	IDA	cellular component
GO:0044615	nuclear pore nuclear basket	IDA	cellular component
GO:0042405	nuclear inclusion body	IDA	cellular component
GO:0042405	nuclear inclusion body	IDA	cellular component
GO:0031990	mRNA export from nucleus in response to heat stress	IDA	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031072	heat shock protein binding	IDA	molecular function
GO:0006606	protein import into nucleus	IDA	NOT|biological process
GO:0006404	RNA import into nucleus	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1901673	regulation of mitotic spindle assembly	IMP	biological process
GO:0090316	positive regulation of intracellular protein transport	IMP	biological process
GO:0090267	positive regulation of mitotic cell cycle spindle assembly checkpoint	IMP	biological process
GO:0051292	nuclear pore complex assembly	IMP	NOT|biological process
GO:0046832	negative regulation of RNA export from nucleus	IMP	biological process
GO:0046827	positive regulation of protein export from nucleus	ISS	biological process
GO:0046825	regulation of protein export from nucleus	IMP	NOT|biological process
GO:0045947	negative regulation of translational initiation	IMP	biological process
GO:0043495	protein-membrane adaptor activity	IMP	NOT|molecular function
GO:0042307	positive regulation of protein import into nucleus	IMP	biological process
GO:0042306	regulation of protein import into nucleus	IMP	NOT|biological process
GO:0031453	positive regulation of heterochromatin assembly	IMP	biological process
GO:0010965	regulation of mitotic sister chromatid separation	IMP	biological process
GO:0010793	regulation of mRNA export from nucleus	IMP	NOT|biological process
GO:0006611	protein export from nucleus	IMP	NOT|biological process
GO:0006405	RNA export from nucleus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043578	nuclear matrix organization	IMP	NOT|biological process
GO:0035457	cellular response to interferon-alpha	ISS	biological process
GO:0031647	regulation of protein stability	IMP	NOT|biological process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological process
GO:0006999	nuclear pore organization	IMP	NOT|biological process
GO:0006999	nuclear pore organization	IMP	biological process
GO:0006606	protein import into nucleus	IMP	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006606	protein import into nucleus	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0051301	cell division	IEA	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006606	protein import into nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006409	tRNA export from nucleus	TAS	biological process
GO:0016032	viral process	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0060964	regulation of gene silencing by miRNA	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006110	regulation of glycolytic process	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042405	nuclear inclusion body	IEA	cellular component
GO:0035457	cellular response to interferon-alpha	IEA	biological process
GO:0005635	nuclear envelope	IEA	cellular component
GO:0044615	nuclear pore nuclear basket	IEA	cellular component
GO:0042405	nuclear inclusion body	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0034399	nuclear periphery	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0034399	nuclear periphery	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0043657	host cell	IEA	cellular component
GO:0044615	nuclear pore nuclear basket	IDA	cellular component
GO:0090267	positive regulation of mitotic cell cycle spindle assembly checkpoint	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032880	regulation of protein localization	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa03013	RNA transport
hsa05216	Thyroid cancer

Diseases

Associated diseases	References
Thyroid cancer	KEGG:H00032
Thyroid cancer	KEGG:H00032
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R