• Gene id: 7171

Gene Summary

• Gene Symbol: TPM4   Gene   UCSC   Ensembl
• Aliases: HEL-S-108
• Gene name: tropomyosin 4
• Alternate names: tropomyosin alpha-4 chain, TM30p1, epididymis secretory protein Li 108,
• Gene location: 19p13.12-p13.11 (16067506: 16103004)     Exons: 15     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-
• OMIM: 600317

Protein Summary

• Protein general information: P67936  
  • Name: Tropomyosin alpha 4 chain (TM30p1) (Tropomyosin 4)
  • Length: 248  
  • Mass: 28522
  • Tissue specificity: Detected in cardiac tissue and platelets, the form found in cardiac tissue is a higher molecular weight than the form found in platelets. Expressed at higher levels in the platelets of hypertensive patients with cardiac hypertrophy tha
• Sequence:

  MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQ
  KLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVS
  ELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLA
  QAKEENVGLHQTLDQTLNELNCI

• Structural information:
  • Interpro: IPR000533  
  • Prosite: PS00326
• Other Databases: GeneCards:  TPM4  Malacards:  TPM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	molecular function
GO:0007015	actin filament organization	IBA	biological process
GO:0006936	muscle contraction	IBA	biological process
GO:0005884	actin filament	IBA	cellular component
GO:0005509	calcium ion binding	NAS	molecular function
GO:0051015	actin filament binding	ISS	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0042802	identical protein binding	ISS	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008307	structural constituent of muscle	TAS	molecular function
GO:0005862	muscle thin filament tropomyosin	TAS	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006936	muscle contraction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030049	muscle filament sliding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0001649	osteoblast differentiation	HDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04260	Cardiac muscle contraction
hsa05414	Dilated cardiomyopathy
hsa05410	Hypertrophic cardiomyopathy

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881