• Gene id: 7169

Gene Summary

• Gene Symbol: TPM2   Gene   UCSC   Ensembl
• Aliases: AMCD1, DA1, DA2B, DA2B4, HEL-S-273, NEM4, TMSB
• Gene name: tropomyosin 2
• Alternate names: tropomyosin beta chain, epididymis secretory protein Li 273, nemaline myopathy type 4, tropomyosin 2 (beta),
• Gene location: 9p13.3 (35690055: 35681992)     Exons: 11     NC_000009.12
• Gene summary(Entrez): This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease,
• OMIM: 603697

Protein Summary

• Protein general information: P07951  
  • Name: Tropomyosin beta chain (Beta tropomyosin) (Tropomyosin 2)
  • Length: 284  
  • Mass: 32851
  • Tissue specificity: Present in primary breast cancer tissue, absent from normal breast tissue. {ECO
• Sequence:

  MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAE
  KKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKE
  AKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEI
  KLLEEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

• Structural information:
  • Interpro: IPR000533  
  • Prosite: PS00326
• Other Databases: GeneCards:  TPM2  Malacards:  TPM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007015	actin filament organization	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0005884	actin filament	IBA	cellular component
GO:0006936	muscle contraction	IBA	biological process
GO:0015629	actin cytoskeleton	ISS	cellular component
GO:0051015	actin filament binding	ISS	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0042802	identical protein binding	ISS	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008307	structural constituent of muscle	TAS	molecular function
GO:0005862	muscle thin filament tropomyosin	TAS	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030049	muscle filament sliding	TAS	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0043462	regulation of ATPase activity	IDA	biological process
GO:0003779	actin binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04260	Cardiac muscle contraction
hsa05414	Dilated cardiomyopathy
hsa05410	Hypertrophic cardiomyopathy

Diseases

Associated diseases	References
Distal arthrogryposis	KEGG:H00811
Nemaline myopathy	KEGG:H00698
Cap myopathy	KEGG:H00702
Distal arthrogryposis	KEGG:H00811
Nemaline myopathy	KEGG:H00698
Cap myopathy	KEGG:H00702
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881