• Gene id: 7168

Gene Summary

• Gene Symbol: TPM1   Gene   UCSC   Ensembl
• Aliases: C15orf13, CMD1Y, CMH3, HEL-S-265, HTM-alpha, LVNC9, TMSA
• Gene name: tropomyosin 1
• Alternate names: tropomyosin alpha-1 chain, alpha-tropomyosin, cardiomyopathy, hypertrophic 3, epididymis secretory protein Li 265, sarcomeric tropomyosin kappa, tropomyosin 1 (alpha),
• Gene location: 15q22.2 (63042638: 63071914)     Exons: 15     NC_000015.10
• Gene summary(Entrez): This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha
• OMIM: 191010

Protein Summary

• Protein general information: P09493  
  • Name: Tropomyosin alpha 1 chain (Alpha tropomyosin) (Tropomyosin 1)
  • Length: 284  
  • Mass: 32,709
• Sequence:

  MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAE
  KKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKE
  AKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEI
  KVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

• Structural information:
  • Interpro: IPR000533  
  • Prosite: PS00326
  • PDB: 3MUD 5KHT
  • PDBsum: 3MUD 5KHT
• Other Databases: GeneCards:  TPM1  Malacards:  TPM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001725	stress fiber	IDA	cellular component
GO:0003065	positive regulation of heart rate by epinephrine	ISS	biological process
GO:0003779	actin binding	TAS	molecular function
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005862	muscle thin filament tropomyosin	TAS	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006936	muscle contraction	TAS	biological process
GO:0006937	regulation of muscle contraction	TAS	biological process
GO:0007010	cytoskeleton organization	TAS	biological process
GO:0008016	regulation of heart contraction	TAS	biological process
GO:0008092	cytoskeletal protein binding	IPI	molecular function
GO:0008307	structural constituent of muscle	TAS	molecular function
GO:0008360	regulation of cell shape	IMP	biological process
GO:0030017	sarcomere	TAS	cellular component
GO:0030049	muscle filament sliding	ISS	biological process
GO:0030049	muscle filament sliding	TAS	biological process
GO:0030336	negative regulation of cell migration	ISS	biological process
GO:0031529	ruffle organization	ISS	biological process
GO:0031941	filamentous actin	IEA	cellular component
GO:0032059	bleb	IMP	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0032781	positive regulation of ATPase activity	ISS	biological process
GO:0034614	cellular response to reactive oxygen species	IEP	biological process
GO:0042060	wound healing	ISS	biological process
GO:0045214	sarcomere organization	IMP	biological process
GO:0045785	positive regulation of cell adhesion	ISS	biological process
GO:0051496	positive regulation of stress fiber assembly	ISS	biological process
GO:0055010	ventricular cardiac muscle tissue morphogenesis	IMP	biological process
GO:0060048	cardiac muscle contraction	IMP	biological process
GO:1904706	negative regulation of vascular smooth muscle cell proliferation	IMP	biological process
GO:1904753	negative regulation of vascular associated smooth muscle cell migration	IMP	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001725	stress fiber	IDA	cellular component
GO:0003065	positive regulation of heart rate by epinephrine	IEA	biological process
GO:0003065	positive regulation of heart rate by epinephrine	ISS	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0003779	actin binding	TAS	molecular function
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005862	muscle thin filament tropomyosin	TAS	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006936	muscle contraction	TAS	biological process
GO:0006937	regulation of muscle contraction	TAS	biological process
GO:0007010	cytoskeleton organization	TAS	biological process
GO:0008016	regulation of heart contraction	TAS	biological process
GO:0008092	cytoskeletal protein binding	IPI	molecular function
GO:0008307	structural constituent of muscle	TAS	molecular function
GO:0008360	regulation of cell shape	IMP	biological process
GO:0030016	myofibril	IEA	cellular component
GO:0030017	sarcomere	TAS	cellular component
GO:0030049	muscle filament sliding	ISS	biological process
GO:0030049	muscle filament sliding	TAS	biological process
GO:0030336	negative regulation of cell migration	ISS	biological process
GO:0031529	ruffle organization	ISS	biological process
GO:0031941	filamentous actin	IEA	cellular component
GO:0032059	bleb	IMP	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0032781	positive regulation of ATPase activity	ISS	biological process
GO:0034614	cellular response to reactive oxygen species	IEP	biological process
GO:0042060	wound healing	ISS	biological process
GO:0045214	sarcomere organization	IMP	biological process
GO:0045785	positive regulation of cell adhesion	ISS	biological process
GO:0051496	positive regulation of stress fiber assembly	ISS	biological process
GO:0055010	ventricular cardiac muscle tissue morphogenesis	IEA	biological process
GO:0055010	ventricular cardiac muscle tissue morphogenesis	IMP	biological process
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:0060048	cardiac muscle contraction	IMP	biological process
GO:1904706	negative regulation of vascular smooth muscle cell proliferation	IMP	biological process
GO:1904753	negative regulation of vascular associated smooth muscle cell migration	IMP	biological process
GO:0001725	stress fiber	IDA	cellular component
GO:0003065	positive regulation of heart rate by epinephrine	ISS	biological process
GO:0003779	actin binding	TAS	molecular function
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005862	muscle thin filament tropomyosin	TAS	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006936	muscle contraction	TAS	biological process
GO:0006937	regulation of muscle contraction	TAS	biological process
GO:0007010	cytoskeleton organization	TAS	biological process
GO:0008016	regulation of heart contraction	TAS	biological process
GO:0008092	cytoskeletal protein binding	IPI	molecular function
GO:0008307	structural constituent of muscle	TAS	molecular function
GO:0008360	regulation of cell shape	IMP	biological process
GO:0030017	sarcomere	TAS	cellular component
GO:0030049	muscle filament sliding	ISS	biological process
GO:0030049	muscle filament sliding	TAS	biological process
GO:0030336	negative regulation of cell migration	ISS	biological process
GO:0031529	ruffle organization	ISS	biological process
GO:0032059	bleb	IMP	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0032781	positive regulation of ATPase activity	ISS	biological process
GO:0034614	cellular response to reactive oxygen species	IEP	biological process
GO:0042060	wound healing	ISS	biological process
GO:0045214	sarcomere organization	IMP	biological process
GO:0045785	positive regulation of cell adhesion	ISS	biological process
GO:0051496	positive regulation of stress fiber assembly	ISS	biological process
GO:0055010	ventricular cardiac muscle tissue morphogenesis	IMP	biological process
GO:0060048	cardiac muscle contraction	IMP	biological process
GO:1904706	negative regulation of vascular smooth muscle cell proliferation	IMP	biological process
GO:1904753	negative regulation of vascular associated smooth muscle cell migration	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04260	Cardiac muscle contraction
hsa04261	Adrenergic signaling in cardiomyocytes
hsa05206	MicroRNAs in cancer
hsa05410	Hypertrophic cardiomyopathy
hsa05414	Dilated cardiomyopathy

Diseases

Associated diseases	References
Cardiovascular disease	GAD: 8774330
Cardiomyopathy	OMIM: 191010
Dilated cardiomyopathy	KEGG: H00294
Left ventricular noncompaction	OMIM: 191010
Metabolic syndrome	GAD: 20075843
Nemaline myopathy	GAD: 7704029
Asthenozoospermia	MIK: 21898990
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenospermia	MIK: 21898990
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21898990	Asthenospermia				Male infertility	KIF3B MYO15A KIF6 KIF26B KIF3A DNHD2 DMN DYNC2H1 STARD9 MYOHD1 and TPM1
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R