• Gene id: 7165

Gene Summary

• Gene Symbol: TPD52L2   Gene   UCSC   Ensembl
• Aliases: D54, TPD54
• Gene name: TPD52 like 2
• Alternate names: tumor protein D54, HCCR-binding protein 2, tumor protein D52 like 2,
• Gene location: 20q13.33 (63865227: 63891544)     Exons: 2     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the tumor protein D52-like family. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. Expression of this gene m
• OMIM: 603747

Protein Summary

• Protein general information: O43399  
  • Name: Tumor protein D54 (hD54) (Tumor protein D52 like 2)
  • Length: 206  
  • Mass: 22238
• Sequence:

  MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCG
  ELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSA
  ISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF

• Structural information:
  • Interpro: IPR012341  IPR007327  
• Other Databases: GeneCards:  TPD52L2  Malacards:  TPD52L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)