• Gene id: 7164

Gene Summary

• Gene Symbol: TPD52L1   Gene   UCSC   Ensembl
• Aliases: D53, TPD53
• Gene name: TPD52 like 1
• Alternate names: tumor protein D53, tumor protein D52 like 1,
• Gene location: 6q22.31 (125153729: 125264406)     Exons: 12     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of a family of proteins that contain coiled-coil domains and may form hetero- or homomers. The encoded protein is involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase
• OMIM: 604069

Protein Summary

• Protein general information: Q16890  
  • Name: Tumor protein D53 (hD53) (Tumor protein D52 like 1)
  • Length: 204  
  • Mass: 22449
• Sequence:

  MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNL
  MNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSF
  EERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC

• Structural information:
  • Interpro: IPR007327  
  • STRING: ENSP00000434142
• Other Databases: GeneCards:  TPD52L1  Malacards:  TPD52L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0000086	G2/M transition of mitotic cell cycle	IDA	biological process
GO:2001235	positive regulation of apoptotic signaling pathway	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881